[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yvyG
DDBJ      :yvyG         putative flagellar protein
Swiss-Prot:YVYG_BACSU   RecName: Full=Uncharacterized protein yvyG;

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.47.5
:160 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->131 2fupA1 a.47.5.1 * 1e-15 24.8 %
:RPS:PFM   6->124 PF05130 * FlgN 5e-06 29.1 %
:HMM:PFM   1->141 PF05130 * FlgN 3.7e-28 30.1 136/143  
:BLT:SWISS 1->160 YVYG_BACSU 9e-77 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15559.1 GT:GENE yvyG GT:PRODUCT putative flagellar protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3639787..3640269) GB:FROM 3639787 GB:TO 3640269 GB:DIRECTION - GB:GENE yvyG GB:PRODUCT putative flagellar protein GB:FUNCTION 16.5: Explore GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type ps: putative structure GB:PROTEIN_ID CAB15559.1 GB:DB_XREF GOA:P39808 InterPro:IPR007809 SubtiList:BG10400 UniProtKB/Swiss-Prot:P39808 GB:GENE:GENE yvyG LENGTH 160 SQ:AASEQ MSAKAIIEQLKRLCVLHEHLLTLSEEKTEALKAGKTKELSNILTKEQKYIQAITQTEDDRIKTTSAFLGYSENNTISACIAKTSGSEKEELEQLYESLSQVLGRLKKVNEMNRQLTRDALQFISISYDMLVPKENNFNYSKSIKAELPKSSKMKLFDSKA GT:EXON 1|1-160:0| SW:ID YVYG_BACSU SW:DE RecName: Full=Uncharacterized protein yvyG; SW:GN Name=yvyG; Synonyms=yviC; OrderedLocusNames=BSU35420; SW:KW Bacterial flagellum biogenesis; Complete proteome; Phosphoprotein. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->160|YVYG_BACSU|9e-77|100.0|160/100| GO:SWS:NREP 1 GO:SWS GO:0043064|"GO:flagellum organization"|Bacterial flagellum biogenesis| SEG 86->99|sekeeleqlyesls| RP:PFM:NREP 1 RP:PFM:REP 6->124|PF05130|5e-06|29.1|117/144|FlgN| HM:PFM:NREP 1 HM:PFM:REP 1->141|PF05130|3.7e-28|30.1|136/143|FlgN| GO:PFM:NREP 2 GO:PFM GO:0009296|"GO:flagellum assembly"|PF05130|IPR007809| GO:PFM GO:0019861|"GO:flagellum"|PF05130|IPR007809| HM:SCP:REP 1->131|2fupA1|1e-15|24.8|129/0|a.47.5.1|1/1|FlgN-like| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------1111---11111------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 135-153, 158-160| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccc //