[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ywdA
DDBJ      :ywdA         hypothetical protein
Swiss-Prot:YWDA_BACSU   RecName: Full=Uncharacterized protein ywdA;

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:82 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->41 PF06013 * WXG100 4.9e-05 34.3 35/86  
:BLT:SWISS 1->82 YWDA_BACSU 3e-43 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15829.1 GT:GENE ywdA GT:PRODUCT hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3901868..3902116) GB:FROM 3901868 GB:TO 3902116 GB:DIRECTION - GB:GENE ywdA GB:PRODUCT hypothetical protein GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB15829.1 GB:DB_XREF SubtiList:BG10597 UniProtKB/Swiss-Prot:P39609 GB:GENE:GENE ywdA LENGTH 82 SQ:AASEQ MNIHEQKITPECLEKAANQVEDKREEYKDVLLQLKKMLGGTTPHSETAEILTRAYEQMKEYALFVQSIETFLRKSANNLKIK GT:EXON 1|1-82:0| SW:ID YWDA_BACSU SW:DE RecName: Full=Uncharacterized protein ywdA; SW:GN Name=ywdA; OrderedLocusNames=BSU38030; ORFNames=ipa-51d; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->82|YWDA_BACSU|3e-43|100.0|82/82| HM:PFM:NREP 1 HM:PFM:REP 7->41|PF06013|4.9e-05|34.3|35/86|WXG100| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //