[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ywdD
DDBJ      :ywdD         putative integral inner membrane protein
Swiss-Prot:YWDD_BACSU   RecName: Full=Uncharacterized protein ywdD;

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:211 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   1->63 PF08006 * DUF1700 2.6e-07 43.9 57/181  
:HMM:PFM   139->152 PF12124 * Nsp3_PL2pro 0.00068 64.3 14/66  
:BLT:SWISS 1->211 YWDD_BACSU e-113 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15826.2 GT:GENE ywdD GT:PRODUCT putative integral inner membrane protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3899853..3900488) GB:FROM 3899853 GB:TO 3900488 GB:DIRECTION - GB:GENE ywdD GB:PRODUCT putative integral inner membrane protein GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pm: putative membrane component GB:PROTEIN_ID CAB15826.2 GB:DB_XREF GOA:P39612 SubtiList:BG10600 UniProtKB/Swiss-Prot:P39612 GB:GENE:GENE ywdD LENGTH 211 SQ:AASEQ MDKETYVSEIKSGLKGLPEGEAMIEEIESHIEHHLFRSFQEGKSEEEAMQTLLQAFGTPTDIVSSFKKIQPVTFRAFLMFHLFCNSALFAVGIAITIMHVWLESPFVQAVWKGISVSVWLILAAYMIYWVLIGYQGVKEFGKRGEKLVLHTILISMVPNVIFMLVFLFNVIPAALFQSLLTPWFVGTCAFATLLFPLFGRMGCYIGRRQLV GT:EXON 1|1-211:0| SW:ID YWDD_BACSU SW:DE RecName: Full=Uncharacterized protein ywdD; SW:GN Name=ywdD; OrderedLocusNames=BSU38000; ORFNames=ipa-54d; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->211|YWDD_BACSU|e-113|100.0|211/100| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 4 TM:REGION 75->97| TM:REGION 111->133| TM:REGION 151->173| TM:REGION 183->205| SEG 24->34|ieeieshiehh| HM:PFM:NREP 2 HM:PFM:REP 1->63|PF08006|2.6e-07|43.9|57/181|DUF1700| HM:PFM:REP 139->152|PF12124|0.00068|64.3|14/66|Nsp3_PL2pro| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 45-45,48-48,53-53,59-59,81-81,87-87,95-95,137-137,165-165| PSIPRED ccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //