[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ywrB
DDBJ      :ywrB         putative anion transporter
Swiss-Prot:YWRB_BACSU   RecName: Full=Uncharacterized transporter ywrB;

Homologs  Archaea  1/68 : Bacteria  231/915 : Eukaryota  20/199 : Viruses  0/175   --->[See Alignment]
:197 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   14->136 PF02417 * Chromate_transp 2e-16 30.9 %
:HMM:PFM   8->176 PF02417 * Chromate_transp 7.4e-42 33.1 166/169  
:BLT:SWISS 1->197 YWRB_BACSU e-103 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15629.1 GT:GENE ywrB GT:PRODUCT putative anion transporter GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3721415..3722008 GB:FROM 3721415 GB:TO 3722008 GB:DIRECTION + GB:GENE ywrB GB:PRODUCT putative anion transporter GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pt: putative transporter GB:PROTEIN_ID CAB15629.1 GB:DB_XREF GOA:O05216 InterPro:IPR003370 SubtiList:BG12521 UniProtKB/Swiss-Prot:O05216 GB:GENE:GENE ywrB LENGTH 197 SQ:AASEQ MKNHPYRDMTAAMVRTGILGFGGGPSVIPLIRHEAVNKYKWIDDDEFGEILAIANALPGPIATKMAAYLGFKLKGTLGAIVAILAHILPTCLAMVGLFAAVNVLSHSAIVAGMIGAVTPVIAVMLGIMAYEFGQKALKGFGWVTGILFFIIAFIGLQTLQINPGLVIIIFLAYGAFHFKLKDKITNKHSKDKGMSAS GT:EXON 1|1-197:0| SW:ID YWRB_BACSU SW:DE RecName: Full=Uncharacterized transporter ywrB; SW:GN Name=ywrB; OrderedLocusNames=BSU36120; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->197|YWRB_BACSU|e-103|100.0|197/197| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 3 TM:REGION 78->100| TM:REGION 109->131| TM:REGION 147->169| SEG 145->156|gilffiiafigl| RP:PFM:NREP 1 RP:PFM:REP 14->136|PF02417|2e-16|30.9|123/170|Chromate_transp| HM:PFM:NREP 1 HM:PFM:REP 8->176|PF02417|7.4e-42|33.1|166/169|Chromate_transp| GO:PFM:NREP 2 GO:PFM GO:0015109|"GO:chromate transmembrane transporter activity"|PF02417|IPR003370| GO:PFM GO:0015703|"GO:chromate transport"|PF02417|IPR003370| OP:NHOMO 334 OP:NHOMOORG 252 OP:PATTERN ----------------------------1--------------------------------------- -1------------------------------------1---1-------------------2------------------------1223212-2-----1-------2-----------------------------11---1-111111--1-11-1---12-111111--11-11-1--1----11---211111111-11111123332221--22-5--------23-------------------------------------------------------------------------------------------24--2222222222-2--111122-12143--2211--121-22--221---111--------11------1-1----------3-21-1122-11--1--1--1---1-21---1-2-1--11--------------1---------------------------------1-------11----1--111---11111-1-5--1---2---111-1-1212-121--111------------111-1---1----122-1-111--------11---------------------------------------1--1-----1--1----11-------1-------------------------------------------11------------------------------------------------------------2----------------11111-----111--11-1-211111-------------1111-----11111------------------11------------1-1--------11------1---1----212111-1---1- --------------1----1--1--------------111111-----12--1-11--1--1-------------------------------1---------------1----------------------------------------------------------------------------------1--1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 185-197| PSIPRED ccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //