[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ywrD
DDBJ      :ywrD         putative gamma-glutamyltransferase
Swiss-Prot:YWRD_BACSU   RecName: Full=Putative gamma-glutamyltransferase ywrD;         EC=2.3.2.2;Contains:  RecName: Full=Gamma-glutamyltranspeptidase large chain;Contains:  RecName: Full=Gamma-glutamyltranspeptidase small chain;

Homologs  Archaea  30/68 : Bacteria  494/915 : Eukaryota  169/199 : Viruses  0/175   --->[See Alignment]
d.153.1
:525 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->520 2nlzD PDBj 1e-80 39.9 %
:RPS:PDB   1->524 2e0wA PDBj e-115 30.1 %
:RPS:SCOP  4->524 2i3oA1  d.153.1.6 * e-131 31.6 %
:HMM:SCOP  1->518 2nqo.1 d.153.1.6 * 8.9e-172 40.0 %
:RPS:PFM   26->520 PF01019 * G_glu_transpept 6e-88 40.0 %
:HMM:PFM   25->520 PF01019 * G_glu_transpept 7.8e-168 39.9 489/510  
:BLT:SWISS 1->525 YWRD_BACSU 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15627.1 GT:GENE ywrD GT:PRODUCT putative gamma-glutamyltransferase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3719134..3720711) GB:FROM 3719134 GB:TO 3720711 GB:DIRECTION - GB:GENE ywrD GB:PRODUCT putative gamma-glutamyltransferase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 14762019; Product type pe : putative enzyme GB:PROTEIN_ID CAB15627.1 GB:DB_XREF GOA:O05218 InterPro:IPR000101 SubtiList:BG12523 UniProtKB/Swiss-Prot:O05218 GB:GENE:GENE ywrD LENGTH 525 SQ:AASEQ MNKSVIGTKQMVVSPHYLASQAGNRILDKGGNAFDAAVAVSACLAVVYPHMTGLGGDSFWLTFHQETKAVKVYNGSGRSGKNVTRDVYKGKSAIPLRGIDSAITVPGMVDSWDAVLKEYGRLSLADVLEPARDYAQNGFPVSADQCRHTEKNIELLASTPYTADIFTRRGKAPVPGERFVQKELADSLNLIAEKGRSAFYEGDLAQRIVSHLQNNGSYMTIDDFKAHRGEWAAPVSSDYRGYSVYQAPPNSQGFTGLLTLNILENYDFTQIEHGSFEYYHVLVEALKKSFLDRDAVLTDPAFADIPLERLLDKRYAKQLAEEIGYLAIPAESRPVGSDTAYAAVIDADGNAVSFIQSLYFEFGSAVTAGDTGILLQNRGSFFSLDENHVNTLEPRKRTFHTLMPAMVCKGGKPKILYGTQGGEGQPQTQTAIITRMLDYGMHPQQAISEPRWVWGRTWGEEYEGLRVEGRFTDKTIQKLKDSGHLVEVVGDYDPLMGQAAAIKVDEEGFLQGGADPRGDGAAVGI GT:EXON 1|1-525:0| SW:ID YWRD_BACSU SW:DE RecName: Full=Putative gamma-glutamyltransferase ywrD; EC=2.3.2.2;Contains: RecName: Full=Gamma-glutamyltranspeptidase large chain;Contains: RecName: Full=Gamma-glutamyltranspeptidase small chain; SW:GN Name=ywrD; OrderedLocusNames=BSU36100; SW:KW Acyltransferase; Complete proteome; Transferase; Zymogen. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->525|YWRD_BACSU|0.0|100.0|525/525| GO:SWS:NREP 2 GO:SWS GO:0008415|"GO:acyltransferase activity"|Acyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 33->47|afdaavavsaclavv| SEG 418->430|gtqggegqpqtqt| BL:PDB:NREP 1 BL:PDB:REP 11->520|2nlzD|1e-80|39.9|494/537| RP:PDB:NREP 1 RP:PDB:REP 1->524|2e0wA|e-115|30.1|475/496| RP:PFM:NREP 1 RP:PFM:REP 26->520|PF01019|6e-88|40.0|487/504|G_glu_transpept| HM:PFM:NREP 1 HM:PFM:REP 25->520|PF01019|7.8e-168|39.9|489/510|G_glu_transpept| GO:PFM:NREP 1 GO:PFM GO:0003840|"GO:gamma-glutamyltransferase activity"|PF01019|IPR000101| RP:SCP:NREP 1 RP:SCP:REP 4->524|2i3oA1|e-131|31.6|493/504|d.153.1.6| HM:SCP:REP 1->518|2nqo.1|8.9e-172|40.0|512/0|d.153.1.6|1/1|N-terminal nucleophile aminohydrolases (Ntn hydrolases)| OP:NHOMO 1474 OP:NHOMOORG 693 OP:PATTERN 111-1-1111111111-111111----11111-----------------------------1111--1 -3412--1111-1-11122-21--2422222112221-22----11---11-112--2--111-222221------------2--2-------------1-11122-221--------------------------11122---13124-111111211---111-31112--1---------11111---1-2-1-11----1-----112212---111-3--------31-11111111111111-11-------------------------------------------------------------------------2--------------1-----------1----11-----1-------2-4--3332-----1165611533332----------1-33533334222-52242223321141-2132121223332222222212232123------------------------------1132147645655555233334454333323554434412223325225131454611---1--11111111-11-1------11-1--1----------111113--1------111-1-1111111-----11111411223122222211122221211222---14-1------11321221111111111-111111111111111111122222111111111111111111131-11111--1-1-111-1111---2-----111111122---11----------111111211111333322242222321221111111112-11122122111--22333331111111---1221111--------------------------------------1---1----1- ------1-----12232232222434222222232222222222223344324333312222112-11-1--1-1-----11112122-232224333332234221241H6A6781211113241194KaA-742-11132123-212131-4343335CB49663838256B32-11G---1212182512332111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 525 STR:RPRED 100.0 SQ:SECSTR ccccEEEcccEEEEccHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHcTTTcccccEEEEEcEEcTTccEEEEEEcccccTTTccTTccccHHHcccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcEEccHHHHHHHHHTHHHHcTTcHHHHHHEETTEEccTTcEEccHHHHHHHHHHHHHcTHHHHHcHHHHHHHHHHHHccccccHHHHHTcccEEEccEEEEETTEEEEEccTTcccHHHHHHHHHHHTcccccccTTcHHHHHHHHHHHHHHHHHHGGGcccGcTTGccHGGGGcHHHHHHHHHHccHHHHcccccccccccEEEEEEcTTccEEEEEEEcccTTTTccccGGGccccccGGGcccccccGGGccccccccccccccEEEEETTEEEEEEccccTTHHHHHHHHHHHHHHTccccHHHHHHcccEEccTTTTcEcccEEEcccccHHHHHHHHHTTccEEEccccTccccccEEEEEcTTccEEEEEcTTcTcEEEEc DISOP:02AL 1-2, 329-332| PSIPRED cccccEEEccEEEccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccEEEEEEEccccEEEEEEccccccccccHHHHccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHccEEEcHHHHHHHHHHHHHHHccccHHHHHcccccccccccccccHHHHHHHHHHHHcccHHHcccHHHHHHHHHHHHccccccHHHHccccEEEEccEEEEcccEEEEEcccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHcccHHHHHHHHHHcccccccccccccccccEEEEEEcccccEEEEEEccccccccEEEEcccEEEEEccccccccccccccccccccccHHHHHHHHEEccccEEEEEEEccccHHHHHHHHHHHHHHHccccHHHHHHcccEEccccccccccEEEEcccccHHHHHHHHHcccEEEEEccccccEEEEEEEEEccccEEEEEEEEccccEEccc //