[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ywrE
DDBJ      :ywrE         conserved hypothetical protein
Swiss-Prot:YWRE_BACSU   RecName: Full=Uncharacterized protein ywrE;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:111 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->65 PF00654 * Voltage_CLC 1.3e-05 20.6 63/355  
:HMM:PFM   45->96 PF09973 * DUF2208 0.00013 26.9 52/233  
:BLT:SWISS 1->111 YWRE_BACSU 7e-55 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15626.1 GT:GENE ywrE GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3718794..3719129 GB:FROM 3718794 GB:TO 3719129 GB:DIRECTION + GB:GENE ywrE GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB15626.1 GB:DB_XREF GOA:O05219 SubtiList:BG12524 UniProtKB/Swiss-Prot:O05219 GB:GENE:GENE ywrE LENGTH 111 SQ:AASEQ MTNFWILMLIAITISLASQFFIKKKYGIDKSGWRYKHVSNTHKWIEITLLILFVFSLSFFPVEYLLLLFFIVIDSIRIFMEWHYRPEDKQYMYHIVEVSLMFMLLIYVCTL GT:EXON 1|1-111:0| SW:ID YWRE_BACSU SW:DE RecName: Full=Uncharacterized protein ywrE; SW:GN Name=ywrE; OrderedLocusNames=BSU36090; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->111|YWRE_BACSU|7e-55|100.0|111/100| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 3 TM:REGION 4->22| TM:REGION 52->74| TM:REGION 90->111| SEG 49->60|llilfvfslsff| HM:PFM:NREP 2 HM:PFM:REP 2->65|PF00654|1.3e-05|20.6|63/355|Voltage_CLC| HM:PFM:REP 45->96|PF09973|0.00013|26.9|52/233|DUF2208| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 45-45| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcc //