[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ywrF
DDBJ      :ywrF         conserved hypothetical protein
Swiss-Prot:YWRF_BACSU   RecName: Full=Uncharacterized protein ywrF;

Homologs  Archaea  8/68 : Bacteria  237/915 : Eukaryota  71/199 : Viruses  0/175   --->[See Alignment]
b.45.1
:205 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->201 3bpkB PDBj 1e-59 55.7 %
:RPS:PDB   1->201 3bpkB PDBj 1e-41 49.5 %
:RPS:SCOP  1->201 1ejeA  b.45.1.2 * 1e-33 30.3 %
:HMM:SCOP  1->202 1ejeA_ b.45.1.2 * 1.2e-42 34.9 %
:RPS:PFM   22->166 PF01613 * Flavin_Reduct 1e-13 34.6 %
:HMM:PFM   23->169 PF01613 * Flavin_Reduct 1e-24 25.7 136/155  
:BLT:SWISS 1->205 YWRF_BACSU e-115 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15625.1 GT:GENE ywrF GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3717999..3718616 GB:FROM 3717999 GB:TO 3718616 GB:DIRECTION + GB:GENE ywrF GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB15625.1 GB:DB_XREF GOA:O05220 HSSP:1EJE InterPro:IPR012349 SubtiList:BG12525 UniProtKB/Swiss-Prot:O05220 GB:GENE:GENE ywrF LENGTH 205 SQ:AASEQ MYIFQADQLSAKDTYKLLSGTVIPRPIAFVTTLSSGGAVNAAPFSFYNVVSSDPPLLSISVNRTEGRQKDTARNAVENGEFVVHVSDEAIIEDINETAASLRPDESELTRTSLHPVESKAVSVPGIKEARVRFECKLERHITFDNDQGITTADLLIGRVVCFHLDEKVYDAEKGYILTDELKPASRLAGNHYAKLGEEFTLIRPS GT:EXON 1|1-205:0| SW:ID YWRF_BACSU SW:DE RecName: Full=Uncharacterized protein ywrF; SW:GN Name=ywrF; OrderedLocusNames=BSU36080; SW:KW Complete proteome; Flavoprotein; FMN. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->205|YWRF_BACSU|e-115|100.0|205/205| BL:PDB:NREP 1 BL:PDB:REP 7->201|3bpkB|1e-59|55.7|192/200| RP:PDB:NREP 1 RP:PDB:REP 1->201|3bpkB|1e-41|49.5|198/200| RP:PFM:NREP 1 RP:PFM:REP 22->166|PF01613|1e-13|34.6|133/150|Flavin_Reduct| HM:PFM:NREP 1 HM:PFM:REP 23->169|PF01613|1e-24|25.7|136/155|Flavin_Reduct| RP:SCP:NREP 1 RP:SCP:REP 1->201|1ejeA|1e-33|30.3|185/192|b.45.1.2| HM:SCP:REP 1->202|1ejeA_|1.2e-42|34.9|186/192|b.45.1.2|1/1|FMN-binding split barrel| OP:NHOMO 432 OP:NHOMOORG 316 OP:PATTERN ----------------------------------2-----11-----1-1321--------------- 1------------------------1-----------211----1---------1----------------------------1-111-------------111111--1-----------------------------11------------------------------------------1-1-----1-1111111121111111111111111-----1111111111-22222212222222222111---11---------11------111-------------------------------------------1-1---------------------------------1----------------12----------422---2112111111111111-11111111-1--33322213332321---1112222111--------1-----11--------------------------------2---1--31111111----1122-------14-4------11-3--1-3213-1-----1----------------------------------------------1-----------1---------111-----2--1-111-2111-1-111111--1----------------1---11------------------------------111---------------------1---------1---------------------1----111------------------------1--1111112111111-111---------11--------1-1--1111111111--------------------------------------------------------------- --------------13222312135331111-1----------111221222421111111-111----1--1-1------11111---37121211111111-------3------------------------------------------------------------------11----12----2--1--211- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 204 STR:RPRED 99.5 SQ:SECSTR cccccGGGccHHHHHHHHHHHcccEEcEEEEEEcTTccEEEEEEccEEEEETTTTEEEEEEEccTTcccHHHHHHHHHcEEEEEEccTTTHHHHHHHTccccTTccHHHHTTccEEcccccccccEETTccEEEEEEEEEEEEccccccccEEEEEEEEEEEEEcGGGEEEETTEEcHHHHcccEEccTTcEEccccccccTTT# DISOP:02AL 1-2, 5-7| PSIPRED cEEEcHHHccHHHHcEEEEEEcccccEEEEEEEcccccEEEEEEEEEEEEcccccEEEEEEEcccccHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHcccccccHHHHccccccccccccccEEcccEEEEEEEEEEEEEcccccccccEEEEEEEEEEEEEEcccEEccccEEcHHHHHHHHHHHccccccccEEEEEEccc //