[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ywrJ
DDBJ      :ywrJ         conserved hypothetical protein
Swiss-Prot:YWRJ_BACSU   RecName: Full=Uncharacterized protein ywrJ;

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.1.12
:225 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  165->222 1liuA2  c.1.12.1 * 6e-04 36.4 %
:HMM:PFM   10->29 PF11504 * Colicin_Ia 0.00085 57.9 19/72  
:BLT:SWISS 1->225 YWRJ_BACSU e-131 100.0 %
:REPEAT 2|4->78|88->161

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15621.1 GT:GENE ywrJ GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3714002..3714679) GB:FROM 3714002 GB:TO 3714679 GB:DIRECTION - GB:GENE ywrJ GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function; PubMedId: 14762006 GB:PROTEIN_ID CAB15621.1 GB:DB_XREF SubtiList:BG12526 UniProtKB/Swiss-Prot:O05223 GB:GENE:GENE ywrJ LENGTH 225 SQ:AASEQ MKGLNQFLNTDVEVVISGDTRFVGTLIDIGQDIFVIFDGCNYLYIPLLHLHQINKAKIVTSTEKPFLINPEDPMIEAETQAFSYRNTLNKVKGQFIEVYVTGGRSIHGYVTNVLNDYIVFFSPVFKILFISMHHLKWFTPYSTEQTPYTLDNSQLPVVPSKVPLVRNFEEQIKKNIGELVIFDMGEVPEKVGLLKGVSNNIIELINASGEPVIWKLNHLKTMHLP GT:EXON 1|1-225:0| SW:ID YWRJ_BACSU SW:DE RecName: Full=Uncharacterized protein ywrJ; SW:GN Name=ywrJ; OrderedLocusNames=BSU36040; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->225|YWRJ_BACSU|e-131|100.0|225/225| NREPEAT 1 REPEAT 2|4->78|88->161| HM:PFM:NREP 1 HM:PFM:REP 10->29|PF11504|0.00085|57.9|19/72|Colicin_Ia| RP:SCP:NREP 1 RP:SCP:REP 165->222|1liuA2|6e-04|36.4|55/281|c.1.12.1| OP:NHOMO 23 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111-111111-----1111111-----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 224-225| PSIPRED cccHHHHcccEEEEEEccccEEEEEEEEEcccEEEEEcccEEEEEEEHHEEEEHHccccccccccccccccccccccccccccHHHHHHHHccEEEEEEEccccEEEEEEEEEcccEEEEEEcccEEEEEEEEccEEEcccccccccEEEccccccEEccccccHHHHHHHHHHHHcEEEEEEccccHHHcEEEEEEcccEEEEEEccccEEEEEEEEEEEEccc //