[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ywrO
DDBJ      :ywrO         nitroreductase
Swiss-Prot:GS14_BACSU   RecName: Full=General stress protein 14;         Short=GSP14;         EC=1.6.99.-;

Homologs  Archaea  3/68 : Bacteria  274/915 : Eukaryota  46/199 : Viruses  0/175   --->[See Alignment]
c.23.5
:175 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->164 3f2vA PDBj 1e-42 46.3 %
:RPS:PDB   2->174 1d4aA PDBj 1e-31 23.8 %
:RPS:SCOP  2->174 1d4aA  c.23.5.3 * 8e-32 23.8 %
:HMM:SCOP  1->174 1dxqA_ c.23.5.3 * 8.9e-51 36.8 %
:RPS:PFM   2->152 PF02525 * Flavodoxin_2 8e-24 45.3 %
:HMM:PFM   1->168 PF02525 * Flavodoxin_2 3.9e-51 39.9 168/196  
:BLT:SWISS 1->175 GS14_BACSU e-102 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15616.1 GT:GENE ywrO GT:PRODUCT nitroreductase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3708172..3708699) GB:FROM 3708172 GB:TO 3708699 GB:DIRECTION - GB:GENE ywrO GB:PRODUCT nitroreductase GB:FUNCTION 16.6: Maintain 16.8: Protect GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 11782522; Product type e: enzyme GB:PROTEIN_ID CAB15616.1 GB:DB_XREF GOA:P80871 HSSP:1QR2 InterPro:IPR003680 SubtiList:BG12528 UniProtKB/Swiss-Prot:P80871 GB:GENE:GENE ywrO LENGTH 175 SQ:AASEQ MKILVLAVHPHMETSVVNKAWAEELSKHDNITVRDLYKEYPDEAIDVAKEQQLCEEYDRIVFQFPLYWYSSPPLLKKWQDLVLTYGWAFGSEGNALHGKELMLAVSTGSEAEKYQAGGANHYSISELLKPFQATSNLIGMKYLPPYVFYGVNYAAAEDISHSAKRLAEYIQQPFV GT:EXON 1|1-175:0| SW:ID GS14_BACSU SW:DE RecName: Full=General stress protein 14; Short=GSP14; EC=1.6.99.-; SW:GN Name=ywrO; OrderedLocusNames=BSU35990; SW:KW Complete proteome; Direct protein sequencing; Oxidoreductase;Stress response. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->175|GS14_BACSU|e-102|100.0|175/175| GO:SWS:NREP 3 GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0006950|"GO:response to stress"|Stress response| BL:PDB:NREP 1 BL:PDB:REP 2->164|3f2vA|1e-42|46.3|162/174| RP:PDB:NREP 1 RP:PDB:REP 2->174|1d4aA|1e-31|23.8|172/273| RP:PFM:NREP 1 RP:PFM:REP 2->152|PF02525|8e-24|45.3|148/193|Flavodoxin_2| HM:PFM:NREP 1 HM:PFM:REP 1->168|PF02525|3.9e-51|39.9|168/196|Flavodoxin_2| GO:PFM:NREP 3 GO:PFM GO:0009055|"GO:electron carrier activity"|PF02525|IPR003680| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF02525|IPR003680| GO:PFM GO:0050662|"GO:coenzyme binding"|PF02525|IPR003680| RP:SCP:NREP 1 RP:SCP:REP 2->174|1d4aA|8e-32|23.8|172/273|c.23.5.3| HM:SCP:REP 1->174|1dxqA_|8.9e-51|36.8|171/0|c.23.5.3|1/1|Flavoproteins| OP:NHOMO 525 OP:NHOMOORG 323 OP:PATTERN ---------------------------------------------------11--------------1 ----1--------------------1------------11-11-----------------11--1------1---111-1-1-----1--1---11----2----312----------------------1----1------------------------------1--------------------------2--1-1111-111111--22-3111---1-111-----14---------------1---1--1-11-2-----11111-1--------------------------------------------------------------1-----------------------------------12---111------1--11---1--1--------------------1-1--1----------21-------1-21------------22----1----------------------------------1----1111111-111111--1111--1111122--2211------1-2--21-1-11------------1-----1------------1--1--1------1-1141-----------------1-----1121---1---1------3---11121131-------------23131312222222222-2222222222223222222454221-1222122222222221242222222--211111111111---1-----------11-1-13-5------22-333432----1-21222---1111111------------2332111113222221----------------11------------1--------------------1------------------1 -----------3----------------------------------------11----------------1--------------------------------------2-8B22121-1--2242-31662-2321111211311221-2-23-122------------2-----------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 174 STR:RPRED 99.4 SQ:SECSTR cEEEEEEccccTTHHHHHHHHHHHHHHTTcEEEEETTTTTcccccHHHHHHHHHHHccEEEEEEEccTTcccHHHHHHHHHHcccTTTccTTccTTTTcEEEEEEEccccTGGGcTTcTTcccHHHHHHHHHTTTGGGTcEEcccEEETTGGGccHHHHHHHHHHHHHHHTTGG# DISOP:02AL 175-176| PSIPRED cEEEEEEEccccccHHHHHHHHHHHHcccccEEEEHHHHcccccccHHHHHHHHHHccEEEEEcccccccccHHHHHHHHHHHHHccccccccccccccEEEEEEEccccHHHccccccccccHHHHHHHHHHHHHHcccEEcccEEEEccccccHHHHHHHHHHHHHHHHHHcc //