[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ywsA
DDBJ      :ywsA         hypothetical protein
Swiss-Prot:YWSA_BACSU   RecName: Full=Uncharacterized protein ywsA;

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:98 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   22->79 PF05505 * Ebola_NP 7.5e-05 22.4 58/717  
:BLT:SWISS 1->98 YWSA_BACSU 2e-53 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15615.1 GT:GENE ywsA GT:PRODUCT hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3707836..3708132 GB:FROM 3707836 GB:TO 3708132 GB:DIRECTION + GB:GENE ywsA GB:PRODUCT hypothetical protein GB:NOTE Evidence 5: No homology to any previously reported sequences; PubMedId: 11782522 GB:PROTEIN_ID CAB15615.1 GB:DB_XREF SubtiList:BG12529 UniProtKB/Swiss-Prot:P96728 GB:GENE:GENE ywsA LENGTH 98 SQ:AASEQ MDQFEAAYESYKARQTTADQENVPSGKEEIIAVRRNEEDNIIAVKTNTGRELDYPTALSEAKSGKLAHVDVFHKYGRDILRSEPDGIKENNLSELPDF GT:EXON 1|1-98:0| SW:ID YWSA_BACSU SW:DE RecName: Full=Uncharacterized protein ywsA; SW:GN Name=ywsA; OrderedLocusNames=BSU35980; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->98|YWSA_BACSU|2e-53|100.0|98/98| HM:PFM:NREP 1 HM:PFM:REP 22->79|PF05505|7.5e-05|22.4|58/717|Ebola_NP| OP:NHOMO 21 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111-111111-----1-111------------11----------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 14-27, 92-95, 97-98| PSIPRED ccHHHHHHHHHHHcccHHHHHccccccccEEEEEEcccccEEEEEEcccccccHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccccccccc //