[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ywsB
DDBJ      :ywsB         conserved hypothetical protein
Swiss-Prot:YWSB_BACSU   RecName: Full=Cell wall-binding protein ywsB;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.34.2
:178 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   67->107 1bk2A PDBj 4e-04 42.5 %
:RPS:SCOP  59->107 1ri9A  b.34.2.1 * 5e-04 24.5 %
:RPS:PFM   57->107 PF08239 * SH3_3 2e-04 49.0 %
:HMM:PFM   56->107 PF08239 * SH3_3 1.6e-17 42.0 50/52  
:HMM:PFM   126->173 PF08239 * SH3_3 3.6e-05 35.0 40/52  
:BLT:SWISS 1->178 YWSB_BACSU 1e-79 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15614.1 GT:GENE ywsB GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3707144..3707680 GB:FROM 3707144 GB:TO 3707680 GB:DIRECTION + GB:GENE ywsB GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function; PubMedId: 15187182 GB:PROTEIN_ID CAB15614.1 GB:DB_XREF HSSP:1BK2 InterPro:IPR001452 SubtiList:BG12530 UniProtKB/Swiss-Prot:P96729 GB:GENE:GENE ywsB LENGTH 178 SQ:AASEQ MNKPTKLFSTLALAAGMTAAAAGGAGTIHAQQPETTVSIDDLYSYPIDSYLVSAEALNVRTKPSASSQKADTLHLGDSLKLISFSNADWAKVKYKNGKTGFVSTHYIVKAATTVKTKTKTKVYTSADGKSIKTLPADTSVSFLGWSKTNKGGFDFDWVFVDYGGTTGYMKTKDLHMTK GT:EXON 1|1-178:0| SW:ID YWSB_BACSU SW:DE RecName: Full=Cell wall-binding protein ywsB;Flags: Precursor; SW:GN Name=ywsB; OrderedLocusNames=BSU35970; SW:KW Cell wall; Complete proteome; Direct protein sequencing; Secreted;Signal. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->178|YWSB_BACSU|1e-79|100.0|178/178| GO:SWS:NREP 2 GO:SWS GO:0005618|"GO:cell wall"|Cell wall| GO:SWS GO:0005576|"GO:extracellular region"|Secreted| SEG 10->27|tlalaagmtaaaaggagt| SEG 108->122|vkaattvktktktkv| BL:PDB:NREP 1 BL:PDB:REP 67->107|1bk2A|4e-04|42.5|40/57| RP:PFM:NREP 1 RP:PFM:REP 57->107|PF08239|2e-04|49.0|49/52|SH3_3| HM:PFM:NREP 2 HM:PFM:REP 56->107|PF08239|1.6e-17|42.0|50/52|SH3_3| HM:PFM:REP 126->173|PF08239|3.6e-05|35.0|40/52|SH3_3| RP:SCP:NREP 1 RP:SCP:REP 59->107|1ri9A|5e-04|24.5|49/77|b.34.2.1| OP:NHOMO 4 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------------2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 41 STR:RPRED 23.0 SQ:SECSTR ##################################################################cTTcccccTTcEEEEEEcccccEEEEEEETTEEEEEEGGGE####################################################################### DISOP:02AL 1-4| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHEEEccccEEccccccEEEEEccEEEEEccEEEEEcccccccEEEEEEEcccEEEEEEEccccEEEEEEccccEEEEEEEEEEccEEEccccccEEEEEccccEEEEEEccccEEEEEEEEcccccEEEccEEEEEEccEEEEEEEEEEEEcc //