[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yxeL
DDBJ      :yxeL         putative acetyltransferase
Swiss-Prot:YXEL_BACSU   RecName: Full=Uncharacterized N-acetyltransferase yxeL;         EC=2.3.1.-;

Homologs  Archaea  0/68 : Bacteria  39/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:165 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   54->120 2ganB PDBj 1e-05 42.4 %
:RPS:PDB   4->161 1cm0B PDBj 5e-13 14.9 %
:RPS:SCOP  51->141 2ganA1  d.108.1.1 * 2e-14 36.4 %
:HMM:SCOP  1->159 1u6mA_ d.108.1.1 * 2.3e-23 27.9 %
:HMM:PFM   57->140 PF00583 * Acetyltransf_1 5.7e-17 25.9 81/83  
:HMM:PFM   22->61 PF05687 * DUF822 0.00033 32.5 40/151  
:BLT:SWISS 1->165 YXEL_BACSU 5e-97 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15987.2 GT:GENE yxeL GT:PRODUCT putative acetyltransferase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(4060307..4060804) GB:FROM 4060307 GB:TO 4060804 GB:DIRECTION - GB:GENE yxeL GB:PRODUCT putative acetyltransferase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 12193636, 16513748, 16885442; Product type pe: putative enzyme GB:PROTEIN_ID CAB15987.2 GB:DB_XREF GOA:P54951 InterPro:IPR000182 SubtiList:BG11888 UniProtKB/Swiss-Prot:P54951 GB:GENE:GENE yxeL LENGTH 165 SQ:AASEQ MKPRYRLAVERDAEQLLELTLRAYEPIRKLGIRFAAAHADLDLVLKNIRENACYVMEEDGRIIATITLRMPWGKQPGPYGVPHIWWFAVDPDTGKKGIGTKLLQWLEETILRDTLKVPFVSLGTADKHPWLIEMYERKGYVRSGEQDLGKGHITVYMKKQLRHDL GT:EXON 1|1-165:0| SW:ID YXEL_BACSU SW:DE RecName: Full=Uncharacterized N-acetyltransferase yxeL; EC=2.3.1.-; SW:GN Name=yxeL; OrderedLocusNames=BSU39510; ORFNames=LP9D; SW:KW Acyltransferase; Complete proteome; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->165|YXEL_BACSU|5e-97|100.0|165/165| GO:SWS:NREP 2 GO:SWS GO:0008415|"GO:acyltransferase activity"|Acyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 54->120|2ganB|1e-05|42.4|66/176| RP:PDB:NREP 1 RP:PDB:REP 4->161|1cm0B|5e-13|14.9|148/161| HM:PFM:NREP 2 HM:PFM:REP 57->140|PF00583|5.7e-17|25.9|81/83|Acetyltransf_1| HM:PFM:REP 22->61|PF05687|0.00033|32.5|40/151|DUF822| RP:SCP:NREP 1 RP:SCP:REP 51->141|2ganA1|2e-14|36.4|88/182|d.108.1.1| HM:SCP:REP 1->159|1u6mA_|2.3e-23|27.9|154/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 41 OP:NHOMOORG 39 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-------------------12----------11111--1-11111111111111-11-1---------------------1-----------------------------------------1--------1------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------1-11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 165 STR:RPRED 100.0 SQ:SECSTR HHHEEEEEcccccccccHHHHHHHHHHHHHHHHHcTTccHHHHHHHHTcTTEEEEEEETTEEEEEEEEEEETTTTTEETTEEEEEEEEEcGGGccccHHHHHHHHHHHHHHHHHHHHTTccEEEEEEcTTTHHHHHTTTccccccccHcccTTcEEEEEEcHHHH PSIPRED cccEEEEccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHccccEEEEEEccEEEEEEEEEEccccccccccccEEEEEEEcHHHccccHHHHHHHHHHHHHHHccccEEEEEEEEccccHHHHHHHHHcccEEccEEEcccccEEEEEEEEccccc //