[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yxeN
DDBJ      :yxeN         putative ABC transporter (permease)
Swiss-Prot:YXEN_BACSU   RecName: Full=Probable amino-acid permease protein yxeN;

Homologs  Archaea  30/68 : Bacteria  701/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:224 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   52->160 3dhwA PDBj 2e-08 27.4 %
:RPS:PDB   117->146 3dhwA PDBj 3e-08 33.3 %
:RPS:SCOP  59->219 2r6gG1  f.58.1.1 * 1e-24 17.4 %
:RPS:PFM   52->216 PF00528 * BPD_transp_1 7e-10 29.7 %
:HMM:PFM   35->219 PF00528 * BPD_transp_1 4.2e-28 26.3 179/185  
:BLT:SWISS 1->224 YXEN_BACSU e-109 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15985.1 GT:GENE yxeN GT:PRODUCT putative ABC transporter (permease) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(4058791..4059465) GB:FROM 4058791 GB:TO 4059465 GB:DIRECTION - GB:GENE yxeN GB:PRODUCT putative ABC transporter (permease) GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 12193636, 15849754, 16513748, 16850406, 16885442; Product type pt: putative transporter GB:PROTEIN_ID CAB15985.1 GB:DB_XREF GOA:P54953 InterPro:IPR010065 SubtiList:BG11890 UniProtKB/Swiss-Prot:P54953 GB:GENE:GENE yxeN LENGTH 224 SQ:AASEQ MNTIDWEFMISAFPTLIQALPITLFMAIAAMIFAIIGGLILALITKNKIPVLHQLSKLYISFFRGVPTLVQLFLIYYGLPQLFPEMSKMTALTAAIIGLSLKNAAYLAEIFRAALNSVDDGQLEACLSVGMTKFQAYRRIILPQAIRNAIPATGNTFIGLLKETSLAFTLGVMEMFAQGKMYASGNLKYFETYLAVAIVYWVLTIIYSILQDLFERAMSKPYRT GT:EXON 1|1-224:0| SW:ID YXEN_BACSU SW:DE RecName: Full=Probable amino-acid permease protein yxeN; SW:GN Name=yxeN; OrderedLocusNames=BSU39490; ORFNames=LP9F; SW:KW Amino-acid transport; Cell membrane; Complete proteome; Membrane;Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->224|YXEN_BACSU|e-109|100.0|224/224| GO:SWS:NREP 5 GO:SWS GO:0006865|"GO:amino acid transport"|Amino-acid transport| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 4 TM:REGION 20->42| TM:REGION 58->80| TM:REGION 93->115| TM:REGION 191->213| SEG 22->45|itlfmaiaamifaiigglilalit| BL:PDB:NREP 1 BL:PDB:REP 52->160|3dhwA|2e-08|27.4|106/203| RP:PDB:NREP 1 RP:PDB:REP 117->146|3dhwA|3e-08|33.3|30/203| RP:PFM:NREP 1 RP:PFM:REP 52->216|PF00528|7e-10|29.7|165/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 35->219|PF00528|4.2e-28|26.3|179/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 59->219|2r6gG1|1e-24|17.4|161/284|f.58.1.1| OP:NHOMO 4643 OP:NHOMOORG 735 OP:PATTERN 11--12----------1-1111114--21-2211----1122--2222--1-1----2------2--- ----4313333321411----6--1D------766636C914225283433-769135--2221577B5A4755576631431---------------------------11111111111111-----1--4---222441111-2233223332211111--1--3322-2112--2212-1341111--27455555875566556623398556333754355555396222222222222222222246757AB885676666B93757E533388886665AA999888999986666566666666778BA98888135575645455232344423333122142331AA-4132-1111111171--11125444422M67122412222375347567R-22G22D28EJ23nTTOTWVWViLNOA---36K777945D1111111134511-49----------111111111111111--1-5--21-5GEAGNNNLOKB9DDDFFJTEDEEADHGc77A412A8C95854B9HGMQ244----A44422222---25-11L-897C56CAAA42-23-3-------1--6-4441666664343333333-13----9AC-3-----D-1111--11111111-11-3---1--------BBMM8BFAAAAAA8AA9-AACAAAAAAAAAA9AA99BJQHNM776A8A7AAAAAAAAAA8AG998999932ECCCCCBBCCCC--5-222221111--6AF55553533323333266666-64554-GEDGHQKTAGHCE5MJK----------777A99999AA97711---------------2----------------3627----------------------132-115111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----2------6-----------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 106 STR:RPRED 47.3 SQ:SECSTR ###################################################HHHHHHHHHHHHHHccHHH###HHHHHHHHHHHTTcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHH################################################################ DISOP:02AL 221-224| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //