[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yyaC
DDBJ      :yyaC         conserved hypothetical protein
Swiss-Prot:YYAC_BACSU   RecName: Full=Uncharacterized protein yyaC;

Homologs  Archaea  0/68 : Bacteria  76/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.56.1
:205 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->199 1c8bA_ c.56.1.2 * 4.6e-55 39.6 %
:RPS:PFM   18->180 PF06866 * DUF1256 3e-58 61.3 %
:HMM:PFM   18->180 PF06866 * DUF1256 2.1e-73 54.9 162/164  
:BLT:SWISS 1->205 YYAC_BACSU e-116 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB16132.1 GT:GENE yyaC GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 4204900..4205517 GB:FROM 4204900 GB:TO 4205517 GB:DIRECTION + GB:GENE yyaC GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB16132.1 GB:DB_XREF InterPro:IPR009665 SubtiList:BG10053 UniProtKB/Swiss-Prot:P37521 GB:GENE:GENE yyaC LENGTH 205 SQ:AASEQ MNRKGGLFSSQERVKQYVSHTDAAAAKQIQTILSSSLRKAAGKPIVVVCIGTDRSTGDSLGPLVGMKLKQMQLTRFHVYGTLSDPVHAVNMKDKINDIHKLHKNPFVIAVDACLGRVKSVGSFQIGDGPLKPGAGVQKDLPEVGDLHINGIVNVSGFMEYFVLQNTRLNLVMNMANVLAEGLSLTDRTEWRQERLNPLQRLTGRI GT:EXON 1|1-205:0| SW:ID YYAC_BACSU SW:DE RecName: Full=Uncharacterized protein yyaC; SW:GN Name=yyaC; OrderedLocusNames=BSU40950; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->205|YYAC_BACSU|e-116|100.0|205/205| RP:PFM:NREP 1 RP:PFM:REP 18->180|PF06866|3e-58|61.3|163/165|DUF1256| HM:PFM:NREP 1 HM:PFM:REP 18->180|PF06866|2.1e-73|54.9|162/164|DUF1256| HM:SCP:REP 1->199|1c8bA_|4.6e-55|39.6|197/0|c.56.1.2|1/1|HybD-like| OP:NHOMO 112 OP:NHOMOORG 76 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111222-111------12-------------------------------------------------------------------------------------------2142222223223211222222122--2--111121221111222------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 204-205| PSIPRED ccccccccccccccccEEEEccHHHHHHHHHHHHHHccccccccEEEEEEccccccccccHHHHHHHHHHHcccccEEEEccccccccccHHHHHHHHHHHccccEEEEEEHHHcccccccEEEEccccccccccccccccccccEEEEEEEccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccc //