[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yyaO
DDBJ      :yyaO         conserved hypothetical protein
Swiss-Prot:YYAO_BACSU   RecName: Full=Uncharacterized protein yyaO;

Homologs  Archaea  27/68 : Bacteria  217/915 : Eukaryota  76/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:79 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   2->58 2ec4A PDBj 1e-06 14.3 %
:HMM:SCOP  18->58 1senA_ c.47.1.1 * 4.2e-08 38.5 %
:RPS:PFM   24->58 PF03190 * DUF255 3e-10 76.5 %
:HMM:PFM   8->58 PF03190 * DUF255 1.2e-25 78.0 50/163  
:BLT:SWISS 1->79 YYAO_BACSU 2e-47 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB16116.1 GT:GENE yyaO GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 4189406..4189645 GB:FROM 4189406 GB:TO 4189645 GB:DIRECTION + GB:GENE yyaO GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB16116.1 GB:DB_XREF InterPro:IPR004879 SubtiList:BG10037 UniProtKB/Swiss-Prot:P37509 GB:GENE:GENE yyaO LENGTH 79 SQ:AASEQ MPNKSKPNRLIAEKSPYLLQHAHNPVDWFPWGEEAFAKAKRENKPVLVSIGYSTTCHWWPGIIKSCGTPLKDNRSHFKR GT:EXON 1|1-79:0| SW:ID YYAO_BACSU SW:DE RecName: Full=Uncharacterized protein yyaO; SW:GN Name=yyaO; OrderedLocusNames=BSU40790; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->79|YYAO_BACSU|2e-47|100.0|79/79| RP:PDB:NREP 1 RP:PDB:REP 2->58|2ec4A|1e-06|14.3|56/171| RP:PFM:NREP 1 RP:PFM:REP 24->58|PF03190|3e-10|76.5|34/126|DUF255| HM:PFM:NREP 1 HM:PFM:REP 8->58|PF03190|1.2e-25|78.0|50/163|DUF255| HM:SCP:REP 18->58|1senA_|4.2e-08|38.5|39/0|c.47.1.1|1/1|Thioredoxin-like| OP:NHOMO 357 OP:NHOMOORG 320 OP:PATTERN 1-----1--------1--------11111111--1-------111-1111111--------111--11 -11-1---------1--11-1---111111111111-111111111---11-1-11-1--11211111111-----------111-11--------1-----1111111111111111111111111-111--11111111---11111111111--------1-111111------------11111---1-2-----------------1112-------11------------------------------------------------------------------------------------------------------111111111-1-111-1----11-----1-11-1--1111-------------------11---111-----11111-11111---------1-1-------------11-------------------------1111------------------------------------------------------------------1------1-----1------11------------1-1----111-1-1-1-111-11111111211111111--------------------1-122-----------------------------------11-1--------------------------------------------------------------------------------------------1---------1-1-----------------------------------------------------------1----------------------------111111----------------------------------------------11- ----11--------1--111----1----1-11----------1---1-----------------------------------------12-----111----11--1-1221111-1-1-11111-313D1-313-11121111-1-1-1--11111------1121114311---1-----111--1111------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 60 STR:RPRED 75.9 SQ:SECSTR EHHHHHHHHHHHHHHHHcccccccccccHHHHHTTTcccTTTccEEEEEETEcccccHEH################### DISOP:02AL 1-4, 8-10, 73-79| PSIPRED cccccccccccccccHHHHHHcccccccccccHHHHHHHHHccccEEEEccccccccccccccccccccccccHHHccc //