[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yyaR
DDBJ      :yyaR         putative acetyl-transferase
Swiss-Prot:YYAR_BACSU   RecName: Full=Uncharacterized protein yyaR;

Homologs  Archaea  0/68 : Bacteria  41/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:173 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   95->148 2i79F PDBj 5e-07 42.6 %
:RPS:PDB   63->146 2a6aB PDBj 6e-13 9.5 %
:RPS:SCOP  40->158 1y9kA1  d.108.1.1 * 5e-17 26.5 %
:HMM:SCOP  27->173 2b5gA1 d.108.1.1 * 2.7e-20 23.6 %
:RPS:PFM   90->147 PF00583 * Acetyltransf_1 4e-07 39.7 %
:HMM:PFM   72->146 PF00583 * Acetyltransf_1 9.6e-21 30.7 75/83  
:BLT:SWISS 1->173 YYAR_BACSU e-104 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB16111.1 GT:GENE yyaR GT:PRODUCT putative acetyl-transferase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(4185160..4185681) GB:FROM 4185160 GB:TO 4185681 GB:DIRECTION - GB:GENE yyaR GB:PRODUCT putative acetyl-transferase GB:FUNCTION 16.8: Protect GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 16579456; Product type pe : putative enzyme GB:PROTEIN_ID CAB16111.1 GB:DB_XREF GOA:P37506 InterPro:IPR008125 SubtiList:BG10033 UniProtKB/Swiss-Prot:P37506 GB:GENE:GENE yyaR LENGTH 173 SQ:AASEQ MIMKMTHLNMKDFNKPNEPFVVFGRMIPAFENGVWTYTEERFSKPYFKQYEDDDMDVSYVEEEGKAAFLYYLENNCIGRIKIRSNWNGYALIEDIAVAKDYRKKGVGTALLHKAIEWAKENHFCGLMLETQDINISACHFYAKHHFIIGAVDTMLYSNFPTANEIAIFWYYKF GT:EXON 1|1-173:0| SW:ID YYAR_BACSU SW:DE RecName: Full=Uncharacterized protein yyaR; SW:GN Name=yyaR; OrderedLocusNames=BSU40740; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->173|YYAR_BACSU|e-104|100.0|173/173| BL:PDB:NREP 1 BL:PDB:REP 95->148|2i79F|5e-07|42.6|54/168| RP:PDB:NREP 1 RP:PDB:REP 63->146|2a6aB|6e-13|9.5|84/186| RP:PFM:NREP 1 RP:PFM:REP 90->147|PF00583|4e-07|39.7|58/80|Acetyltransf_1| HM:PFM:NREP 1 HM:PFM:REP 72->146|PF00583|9.6e-21|30.7|75/83|Acetyltransf_1| GO:PFM:NREP 2 GO:PFM GO:0008080|"GO:N-acetyltransferase activity"|PF00583|IPR000182| GO:PFM GO:0008152|"GO:metabolic process"|PF00583|IPR000182| RP:SCP:NREP 1 RP:SCP:REP 40->158|1y9kA1|5e-17|26.5|113/152|d.108.1.1| HM:SCP:REP 27->173|2b5gA1|2.7e-20|23.6|140/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 43 OP:NHOMOORG 43 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111---11111-----11-1---1-11------11--------------1--1---1--------------------1----------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111---------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------111------111------------------------------------------------------------------------------------------1------ ------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 173 STR:RPRED 100.0 SQ:SECSTR cccTTEEEEEcccGGGHHHHEcccccccHHHTcHHHHHHHHHHHcTTTccHHHHccHTTccTEEEEHHHHHHTccccEEEEEEEEETTEEEEEEEEEcccEEEEEEEEEEEHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHcHHHHHHTccccHHHHcccTHHHHHHT DISOP:02AL 5-6| PSIPRED cccccccccHHHcccccHHHHHHHHHHHHHHccEEEEEEEEccccHHHHccccHHHHHHHcccccEEEEEEEccEEEEEEEEEEccccEEEEEEEEEcHHHHcccHHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHcccEEEEEEcccccccccccHHEEEEEEcc //