[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yybH
DDBJ      :yybH         conserved hypothetical protein
Swiss-Prot:YYBH_BACSU   RecName: Full=Uncharacterized protein yybH;

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->128 2gxfA PDBj 8e-57 100.0 %
:RPS:PDB   1->44 2bngB PDBj 8e-04 29.5 %
:RPS:PDB   15->119 3d9rB PDBj 3e-12 18.6 %
:RPS:SCOP  2->128 2gxfA1  d.17.4.22 * 2e-54 96.6 %
:HMM:SCOP  1->127 1m98A2 d.17.4.6 * 3.5e-18 26.4 %
:HMM:PFM   6->63 PF06878 * Pkip-1 0.0007 26.3 57/163  
:BLT:SWISS 1->129 YYBH_BACSU 1e-71 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB16101.1 GT:GENE yybH GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(4177756..4178145) GB:FROM 4177756 GB:TO 4178145 GB:DIRECTION - GB:GENE yybH GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB16101.1 GB:DB_XREF PDB:2GXF SubtiList:BG10023 UniProtKB/Swiss-Prot:P37496 GB:GENE:GENE yybH LENGTH 129 SQ:AASEQ MEQQLKDIISACDLAIQNEDFDTLMNYYSEDAVLVVKPGMIARGKEEIKKAFITIANYFNHHIVPTQGKMILLEAGDTVLVLSQTLLDSDKKDSEYAMERRATYVFKKNAQGEWLCVIDNSYGTDLIGV GT:EXON 1|1-129:0| SW:ID YYBH_BACSU SW:DE RecName: Full=Uncharacterized protein yybH; SW:GN Name=yybH; OrderedLocusNames=BSU40640; SW:KW 3D-structure; Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->129|YYBH_BACSU|1e-71|100.0|129/100| BL:PDB:NREP 1 BL:PDB:REP 2->128|2gxfA|8e-57|100.0|114/114| RP:PDB:NREP 2 RP:PDB:REP 1->44|2bngB|8e-04|29.5|44/131| RP:PDB:REP 15->119|3d9rB|3e-12|18.6|102/131| HM:PFM:NREP 1 HM:PFM:REP 6->63|PF06878|0.0007|26.3|57/163|Pkip-1| RP:SCP:NREP 1 RP:SCP:REP 2->128|2gxfA1|2e-54|96.6|118/119|d.17.4.22| HM:SCP:REP 1->127|1m98A2|3.5e-18|26.4|121/142|d.17.4.6|1/1|NTF2-like| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------1-------------------------------11111-----------------------------1--------------------------------------------------------1111-------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 128 STR:RPRED 99.2 SQ:SECSTR HHHHHHHHHHHHHHHHHTTcHHHHHHTEEEEEEEcTETcccEEcHHHHHHHHHHHHHHEEEEEEEEEEEEEEEEETTEEEEEEEEEEEETTTccEEEEEEEEEEEEEEcTTccEEEEEEEEccccccc# DISOP:02AL 1-3| PSIPRED cHHHHHHHHHHHHHHHccccHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHcccEEEEcccEEEEEccccHHHHHHHHHcccccccEEEEEEEEEEEEEEccccEEEEEEEcccccEEccc //