[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yybI
DDBJ      :yybI         inner spore coat protein
Swiss-Prot:YYBI_BACSU   RecName: Full=Uncharacterized protein yybI;

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.69.8
:262 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:HMM:SCOP  41->220 1jv2A4 b.69.8.1 * 1.7e-05 20.7 %
:HMM:PFM   94->124 PF01839 * FG-GAP 7.2e-06 43.3 30/33  
:BLT:SWISS 1->262 YYBI_BACSU e-155 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB16100.1 GT:GENE yybI GT:PRODUCT inner spore coat protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(4176900..4177688) GB:FROM 4176900 GB:TO 4177688 GB:DIRECTION - GB:GENE yybI GB:PRODUCT inner spore coat protein GB:FUNCTION 16.5: Explore 16.13: Shape 16.8: Protect GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 16321932; Product type cp: cell process GB:PROTEIN_ID CAB16100.1 GB:DB_XREF SubtiList:BG10022 UniProtKB/Swiss-Prot:P37495 GB:GENE:GENE yybI LENGTH 262 SQ:AASEQ MNVYDIRMAPYWFYEGRGLVQHPYVFRQPVSSRAIIVSTRGDVTGDGVIDEVFLTGNQMPGSPLWRNITLVIRDGRTHQEQRIQLQNNMGYNPSLFLGDMTGDKIEDVAVVMDTGGSGGAIYAYVFAYLNRQFRRIFNSDVLNDELKYSVRYQNQYKASVISHQQNETYILDLTYKGREYLNEIYNSQGVLKMPIEGWVNPLSGLYPVDFDRDGVYELLAYQRIAGRYNADSLGYVQTVLKWNGQRFMFNRQTVTIFGSDLS GT:EXON 1|1-262:0| SW:ID YYBI_BACSU SW:DE RecName: Full=Uncharacterized protein yybI; SW:GN Name=yybI; OrderedLocusNames=BSU40630; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->262|YYBI_BACSU|e-155|100.0|262/100| HM:PFM:NREP 1 HM:PFM:REP 94->124|PF01839|7.2e-06|43.3|30/33|FG-GAP| HM:SCP:REP 41->220|1jv2A4|1.7e-05|20.7|116/0|b.69.8.1|1/1|Integrin alpha N-terminal domain| OP:NHOMO 29 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------11--------2--------------------------------------------------------------------------------------------1-1-1111121-1-1----222-21---------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 71 STR:RPRED 27.1 SQ:SECSTR #########################################################################################################################################################################EEEEEcGGGTcccTTTTHHHHHHHHHHHHHHHHH####HHHGGGTE###########EEEEEEEcccccHHHHHHHHcTT#cccccH###### DISOP:02AL 13-32| PSIPRED ccEEEEEEccEEEEcccccEEccEEEEcccccEEEEEEEccccccccccEEEEEEEEcccccccEEEEEEEEEccccccEEEEEccccccccEEEEEEccccccEEEEEEEEEccccccEEEEEEEEEEccEEEEEcccHHHHHHccEEEEEcccEEEEEEEcccccEEEEEEccccHHHHHHHccccccEEccccccccccccEEEEcccccccccEEEEEEEEEEEEccccEEEEEEEEEcccEEEEEccEEEEEEcccc //