[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yybJ
DDBJ      :yybJ         putative ATP-binding cassette protein
Swiss-Prot:YYBJ_BACSU   RecName: Full=Uncharacterized ABC transporter ATP-binding protein yybJ;

Homologs  Archaea  68/68 : Bacteria  907/915 : Eukaryota  189/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:218 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   1->212 3dhwC PDBj 7e-24 31.1 %
:RPS:PDB   2->217 2dwoA PDBj 3e-34 7.4 %
:RPS:SCOP  1->206 1b0uA  c.37.1.12 * 7e-32 24.8 %
:HMM:SCOP  4->206 1ii8.1 c.37.1.12 * 6.8e-50 31.8 %
:RPS:PFM   43->157 PF00005 * ABC_tran 4e-11 33.6 %
:HMM:PFM   41->157 PF00005 * ABC_tran 3.3e-24 36.3 113/118  
:HMM:PFM   20->48 PF02367 * UPF0079 0.0003 31.0 29/123  
:BLT:SWISS 1->218 YYBJ_BACSU e-114 100.0 %
:PROS 129->143|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB16099.1 GT:GENE yybJ GT:PRODUCT putative ATP-binding cassette protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 4175869..4176525 GB:FROM 4175869 GB:TO 4176525 GB:DIRECTION + GB:GENE yybJ GB:PRODUCT putative ATP-binding cassette protein GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 1938973; Product type pe : putative enzyme GB:PROTEIN_ID CAB16099.1 GB:DB_XREF GOA:P37494 InterPro:IPR003593 SubtiList:BG10021 UniProtKB/Swiss-Prot:P37494 GB:GENE:GENE yybJ LENGTH 218 SQ:AASEQ MIEVLNLTKKIKKTTVLDNISYTFEKGTIYGLFGSNGSGKTMLLRALSGLIVPTEGSITIKGEQLHKDISFPKSVGLIIENMQLLPQYDAFTNLKILSKIKKIASDNDILDSISRVGLENFNSVKVSKFSLGMKQRLNIAQAIFEKPDILLLDEPTNAIDEKGVAFVHDILLQEKKRGATIIITSHHKEDIISLCDIALEMNHGRLETSEKVIYKKDS GT:EXON 1|1-218:0| SW:ID YYBJ_BACSU SW:DE RecName: Full=Uncharacterized ABC transporter ATP-binding protein yybJ; SW:GN Name=yybJ; OrderedLocusNames=BSU40620; SW:KW ATP-binding; Complete proteome; Nucleotide-binding; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->218|YYBJ_BACSU|e-114|100.0|218/218| GO:SWS:NREP 3 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 129->143|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 94->103|lkilskikki| BL:PDB:NREP 1 BL:PDB:REP 1->212|3dhwC|7e-24|31.1|212/343| RP:PDB:NREP 1 RP:PDB:REP 2->217|2dwoA|3e-34|7.4|204/449| RP:PFM:NREP 1 RP:PFM:REP 43->157|PF00005|4e-11|33.6|113/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 41->157|PF00005|3.3e-24|36.3|113/118|ABC_tran| HM:PFM:REP 20->48|PF02367|0.0003|31.0|29/123|UPF0079| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 1->206|1b0uA|7e-32|24.8|206/258|c.37.1.12| HM:SCP:REP 4->206|1ii8.1|6.8e-50|31.8|201/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 32336 OP:NHOMOORG 1164 OP:PATTERN GGF5IECIKMLLKIPIYBGGCDAQaEITPJQLEADCA9GDDDAOXJTZENvjW6JWJQREJDECO145 IPZC*PNOXXaOPMOLKEE-ES88PzEEEEEHZZabf***FZHbVkVPcOLEfYXHIOCCaadReWc*r*MMNNNrQPTDhOW89969POQJ4LAB7--EEPKIDRKTHM56666668798888EPKBMLEELKRKUVUWYDDFeLVSWUSRURUJKE7F9G7NTOTlhgVEJBECECEEDADMJKFDWS6HXk********n*******rrrlm***Tbd*uVdqrspoo**WcdeaebZbccccbbTWSaWoTRVqqUFTMXljKLtwUKOSeWTaWiilkkgnimmhjhfdfhjgifXVXWVXXYZWWVVnddVTUgehhi*ow********f*gl*uubVWX*mfjiffkLD**WVSWZVKSaSeeHMLLHUMIIECGCFGQI***IHXthlwiklknlgnhjj*-UVkQMhTbx*E8**************C9Hit*ifko*opIHIIIIIIVLOAINNh55444666545624773254272277563DC798Ce*takpy*v*vdcZbYyy**ighhSmxr*jnsc9KddWhLRMShbtn**NWQDHDFMGGGGEEDEIKILTQRc*KQJWXKRhNOXDTOOIMKWNMJIKFcbRcGGHOEHFFGDE798787888DBCDEDDXYhLWQWHKHcLKNOLHMTONMPGOQRRRR6-6CH9F11-211sb*tOkZdiifeheidd-idbfhcdfefjhcaccbbb**zz*WVTbYYXaababaaYbYXZtaWUaaZaL3jmpqrppmosss33CHBDBCCHFHHHEeSzQSPWNQCJKIIKIMVIIJHIAKDGLSPbYaZdot*begZfQyuyBA979998AFVffmUWVVWjlhdcKIJFEGFEFF999955ENKJGGFF86576876*7P9689C-779ACA8LLK67G987445OcfLLUmUWUBSG --12PL8-JC3ABHC75734896C5D6774444A96685646645555AC75A6358367863241113-1145212-112---11-3-C6253322224534B68377QLJHJNIODB748FDVX7Y9h*N2MGWDEA7PA9OC8EA99P85*8KFEQEL*ANFL4QMOoEKGF8496*5455ARGLh2ZUCBUFNM6 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 212-214, 216-218| PSIPRED cEEEEEEEEEEccEEEEEcccEEEcccEEEEEEccccccHHHHHHHHHHcccccccEEEEccccccccHHHHHHccEEEccccccccccHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHcccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHcEEEEEEccEEEEccEEcccccc //