[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yybL
DDBJ      :yybL         putative integral inner membrane protein
Swiss-Prot:YYBL_BACSU   RecName: Full=Uncharacterized protein yybL;

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:236 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->236 YYBL_BACSU e-116 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB16097.1 GT:GENE yybL GT:PRODUCT putative integral inner membrane protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 4174410..4175120 GB:FROM 4174410 GB:TO 4175120 GB:DIRECTION + GB:GENE yybL GB:PRODUCT putative integral inner membrane protein GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pm: putative membrane component GB:PROTEIN_ID CAB16097.1 GB:DB_XREF SubtiList:BG10019 UniProtKB/Swiss-Prot:P37492 GB:GENE:GENE yybL LENGTH 236 SQ:AASEQ MKIKRLLLILCLLLFLVTLWFNQNHTYLGKNSIASLLYMNNSTFGYSSIFAYTLFYIVPFLMLLSNFFHSENPYKVMRMVKRKNYYKSKIMEIGFVSLLFSSIHTVINITCTHIFFSKNLLVEANFLSICLLNMISLVFFYLSVGIMFRLTYDLFNSVALAIFIVYIILDSLYFGVKLLLPNGYWEPFRDLAIFTNMLNRYWSTSNLIIVYIRQIIIVFIFYLVGSSIFLNKDYKK GT:EXON 1|1-236:0| SW:ID YYBL_BACSU SW:DE RecName: Full=Uncharacterized protein yybL; SW:GN Name=yybL; OrderedLocusNames=BSU40600; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->236|YYBL_BACSU|e-116|100.0|236/236| TM:NTM 6 TM:REGION 6->20| TM:REGION 45->67| TM:REGION 90->112| TM:REGION 124->146| TM:REGION 160->182| TM:REGION 206->228| SEG 6->19|lllilclllflvtl| SEG 208->222|iivyirqiiivfify| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------1-----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 235-236| PSIPRED ccHHHHHHHHHHHHHHHHHHHccccHHcccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccEEEEcccccc //