[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yybN
DDBJ      :yybN         conserved hypothetical protein
Swiss-Prot:YYBN_BACSU   RecName: Full=Uncharacterized protein yybN;

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:145 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->145 PF10916 * DUF2712 3e-32 54.5 %
:HMM:PFM   1->145 PF10916 * DUF2712 9.4e-87 66.9 145/146  
:BLT:SWISS 1->145 YYBN_BACSU 1e-76 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB16095.1 GT:GENE yybN GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 4173114..4173551 GB:FROM 4173114 GB:TO 4173551 GB:DIRECTION + GB:GENE yybN GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB16095.1 GB:DB_XREF SubtiList:BG10017 UniProtKB/Swiss-Prot:P37490 GB:GENE:GENE yybN LENGTH 145 SQ:AASEQ MNKFLKSNFRFLLAAALGISLLASSNFIKASNDNYKFHLLVPYGYGNAYSNDAFRQTTHTDNPWKVNLQKSAEGKGTIMTFWLINTGNSKIPKASKIHNVKQGSGAHYYHANSQGSHTYVALAVENNNYSASSYGIDGVWDEETW GT:EXON 1|1-145:0| SW:ID YYBN_BACSU SW:DE RecName: Full=Uncharacterized protein yybN; SW:GN Name=yybN; OrderedLocusNames=BSU40580; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->145|YYBN_BACSU|1e-76|100.0|145/100| SEG 12->25|llaaalgisllass| RP:PFM:NREP 1 RP:PFM:REP 1->145|PF10916|3e-32|54.5|145/145|DUF2712| HM:PFM:NREP 1 HM:PFM:REP 1->145|PF10916|9.4e-87|66.9|145/146|DUF2712| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------1-----------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHEEcccccEEEEEEEccccccccccccEEEcccccccEEEEEcccccccEEEEEEEEEEccccccccccEEEEEccccccEEEEcEEccccEEEEEEEEccccccEEEEEcEEEccccc //