[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yybP
DDBJ      :yybP         putative lipoprotein
Swiss-Prot:YYBP_BACSU   RecName: Full=Uncharacterized lipoprotein yybP;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:148 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   64->111 PF03861 * ANTAR 6.1e-06 31.2 48/56  
:BLT:SWISS 1->148 YYBP_BACSU 3e-70 100.0 %
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB16093.1 GT:GENE yybP GT:PRODUCT putative lipoprotein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(4169166..4169612) GB:FROM 4169166 GB:TO 4169612 GB:DIRECTION - GB:GENE yybP GB:PRODUCT putative lipoprotein GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15096624; Product type pt : putative transporter GB:PROTEIN_ID CAB16093.1 GB:DB_XREF GOA:P37488 InterPro:IPR005561 SubtiList:BG10015 UniProtKB/Swiss-Prot:P37488 GB:GENE:GENE yybP LENGTH 148 SQ:AASEQ MKIILTVLAGVGLLSAGGCGMLDQVNDGLNYTSEAAGYVEKVKTFAEEAPELAEKAVNDTEAKEKLEAQLESIQKAAADFNELTPPDAAAEIHRTIQEHNETLQKSAEDVLKQAEEGKVSLKELEQSDLVQNAKQITDVMGQIEKLGE GT:EXON 1|1-148:0| SW:ID YYBP_BACSU SW:DE RecName: Full=Uncharacterized lipoprotein yybP;Flags: Precursor; SW:GN Name=yybP; OrderedLocusNames=BSU40560; SW:KW Cell membrane; Complete proteome; Lipoprotein; Membrane; Palmitate;Signal. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->148|YYBP_BACSU|3e-70|100.0|148/148| GO:SWS:NREP 2 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| COIL:NAA 54 COIL:NSEG 2 COIL:REGION 51->84| COIL:REGION 97->116| TM:NTM 1 TM:REGION 1->23| SEG 5->18|ltvlagvgllsagg| HM:PFM:NREP 1 HM:PFM:REP 64->111|PF03861|6.1e-06|31.2|48/56|ANTAR| OP:NHOMO 23 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111--1111111--------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 147-148| PSIPRED ccEEEEEHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccc //