[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yycD
DDBJ      :yycD         conserved hypothetical protein
Swiss-Prot:YYCD_BACSU   RecName: Full=Uncharacterized protein yycD;

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:66 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   31->57 PF07553 * Lipoprotein_Ltp 1.5e-05 48.1 27/48  
:BLT:SWISS 1->66 YYCD_BACSU 2e-34 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB16082.1 GT:GENE yycD GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 4159005..4159205 GB:FROM 4159005 GB:TO 4159205 GB:DIRECTION + GB:GENE yycD GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB16082.1 GB:DB_XREF InterPro:IPR020086 SubtiList:BG10005 UniProtKB/Swiss-Prot:P37480 GB:GENE:GENE yycD LENGTH 66 SQ:AASEQ MIKKYAITPNVDADGWFIEVENVAPTALYTSKDAAIEKAKQVAKENSPSKLVIYDQFKNVEEEHSF GT:EXON 1|1-66:0| SW:ID YYCD_BACSU SW:DE RecName: Full=Uncharacterized protein yycD; SW:GN Name=yycD; OrderedLocusNames=BSU40450; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->66|YYCD_BACSU|2e-34|100.0|66/100| HM:PFM:NREP 1 HM:PFM:REP 31->57|PF07553|1.5e-05|48.1|27/48|Lipoprotein_Ltp| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------11-1-------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 37-45, 59-66| PSIPRED cEEEEEEcccccccEEEEEEEccccHHHHccHHHHHHHHHHHHHcccccEEEEEEccccccccccc //