[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yydJ
DDBJ      :yydJ         putative permease for export of a regulatory peptide
Swiss-Prot:YYDJ_BACSU   RecName: Full=Probable peptide export permease protein yydJ;

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:240 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   124->152 PF10831 * DUF2556 4.4e-05 37.9 29/53  
:BLT:SWISS 1->240 YYDJ_BACSU e-103 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB16051.1 GT:GENE yydJ GT:PRODUCT putative permease for export of a regulatory peptide GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(4124220..4124942) GB:FROM 4124220 GB:TO 4124942 GB:DIRECTION - GB:GENE yydJ GB:PRODUCT putative permease for export of a regulatory peptide GB:FUNCTION 16.1: Circulate 16.3: Control 16.4: Excrete GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15743949, 15849754, 16850406, 17921301; Product type t: transporter GB:PROTEIN_ID CAB16051.1 GB:DB_XREF GOA:Q45592 SubtiList:BG11483 UniProtKB/Swiss-Prot:Q45592 GB:GENE:GENE yydJ LENGTH 240 SQ:AASEQ MKLEFKKSISNKVIIILGAMFVFLFLLGYFLLVGIDKVSNVTPEMFFFSSYTVATQFGLMLFSFVIAFFINREYSNKNILFYKLIGENIYTFFYKKIAVLFLECFAFITLGLLIISLMYHDFSHFALLLFLFSAVILQYILIIGTISVLCPNILISIGVSIVYWMTSVILVAISNKTFGFIAPFEAGNTMYPRIERVLQSDNMTLGSNDVLFIILYLVSIIIINAIVLRFSKTRWIKMGL GT:EXON 1|1-240:0| SW:ID YYDJ_BACSU SW:DE RecName: Full=Probable peptide export permease protein yydJ; SW:GN Name=yydJ; OrderedLocusNames=BSU40140; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->240|YYDJ_BACSU|e-103|100.0|240/100| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 6 TM:REGION 15->37| TM:REGION 46->68| TM:REGION 97->119| TM:REGION 124->146| TM:REGION 153->175| TM:REGION 207->229| SEG 21->34|fvflfllgyfllvg| SEG 122->134|fshfalllflfsa| SEG 210->228|vlfiilylvsiiiinaivl| HM:PFM:NREP 1 HM:PFM:REP 124->152|PF10831|4.4e-05|37.9|29/53|DUF2556| OP:NHOMO 19 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1-------------------111-1111111111-----1-------------------------111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccHHHHHcccEEEEEHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEcccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHEEccEEEEEEcccccccHHHHHHHHHcccccEEccHHHHHHHHHHHHHHHHHHHHHHHccHHEEEEcc //