Corynebacterium glutamicum R (cglu2)
Gene : BAF52963.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:108 amino acids

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF52963.1 GT:GENE BAF52963.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1594..1920) GB:FROM 1594 GB:TO 1920 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF52963.1 LENGTH 108 SQ:AASEQ MIVDNFVYLWIDFEVRILSPVCADVSPAYPQFLESCAQSGKFRGITFSVTKLTELQVCNYTAVNKVVDNFVSWGFIGSCPQNPCTTPKLQKDPSEDGSSRAAELNFVI GT:EXON 1|1-108:0| TM:NTM 1 TM:REGION 4->26| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 86-101| PSIPRED cccccEEEEEEEEEEEEEcccccccccHHHHHHHHHHcccEEEEEEEEEEEEEEEEEEcHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEEEc //