[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF52972.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   19->69 PF06723 * MreB_Mbl 9.9e-05 25.5 47/327  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF52972.1 GT:GENE BAF52972.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(11261..11524) GB:FROM 11261 GB:TO 11524 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF52972.1 LENGTH 87 SQ:AASEQ MKGLSAENVLAIADEVCAEHGVVVRDFAALAAAAAVSTANFHGVRVFGSAEAMAGKVSEMIRALKPLSGRNETFAAVTQRVLLEINK GT:EXON 1|1-87:0| SEG 28->35|aalaaaaa| HM:PFM:NREP 1 HM:PFM:REP 19->69|PF06723|9.9e-05|25.5|47/327|MreB_Mbl| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,6-6,87-88| PSIPRED cccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccEEEEEEcccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcc //