[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF52985.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  52/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.1a.4.5
:123 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->78 1p6rA PDBj 2e-05 29.2 %
:RPS:PDB   10->83 1bibA PDBj 2e-05 10.1 %
:RPS:SCOP  12->71 2jn6A1  a.4.1.19 * 4e-04 6.9 %
:HMM:SCOP  7->122 1sd4A_ a.4.5.39 * 3.4e-21 29.3 %
:RPS:PFM   10->87 PF03965 * Pencillinase_R 2e-15 51.3 %
:HMM:PFM   10->118 PF03965 * Pencillinase_R 5.9e-32 38.5 109/115  
:BLT:SWISS 10->104 BLAI_MYCTU 2e-13 42.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF52985.1 GT:GENE BAF52985.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 25336..25707 GB:FROM 25336 GB:TO 25707 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF52985.1 LENGTH 123 SQ:AASEQ MNIEQGIPTLGPLEEQVMHILWDRGQLTVREVIEFLPGDPAYTTIATVLRHLGRKGMVTIVKDGRTARHSALMNREEYTASVMDQLLSTSRDRSASILHFVDSITDTDRELLLEYLQQQEGRK GT:EXON 1|1-123:0| BL:SWS:NREP 1 BL:SWS:REP 10->104|BLAI_MYCTU|2e-13|42.1|95/138| SEG 110->120|ellleylqqqe| BL:PDB:NREP 1 BL:PDB:REP 7->78|1p6rA|2e-05|29.2|72/82| RP:PDB:NREP 1 RP:PDB:REP 10->83|1bibA|2e-05|10.1|69/294| RP:PFM:NREP 1 RP:PFM:REP 10->87|PF03965|2e-15|51.3|78/115|Pencillinase_R| HM:PFM:NREP 1 HM:PFM:REP 10->118|PF03965|5.9e-32|38.5|109/115|Pencillinase_R| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF03965|IPR005650| GO:PFM GO:0016481|"GO:negative regulation of transcription"|PF03965|IPR005650| GO:PFM GO:0016566|"GO:specific transcriptional repressor activity"|PF03965|IPR005650| RP:SCP:NREP 1 RP:SCP:REP 12->71|2jn6A1|4e-04|6.9|58/89|a.4.1.19| HM:SCP:REP 7->122|1sd4A_|3.4e-21|29.3|116/0|a.4.5.39|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 57 OP:NHOMOORG 52 OP:PATTERN -------------------------------------------------------------------- --1-2--1111---11111-11111111111111211212--111----111111-----11---11--12--------------1--------------------------------------------------------------1-----------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 77 STR:RPRED 62.6 SQ:SECSTR ######cccccHHHHHHHHHHTTcccccHHHHHHHHTHcccHccHHHHHHHHHHHTcccEEETTTEEEcccccccccHHHHHH######################################## DISOP:02AL 1-5,120-124| PSIPRED cccccccccccHHHHHHHHHHHHcccccHHHHHHHHHccccccHHHHHHHHHHHcccHHHEEccccEEEEEEEcHHHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHHHHcc //