[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53004.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  53/68 : Bacteria  827/915 : Eukaryota  90/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:219 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   1->206 2it1A PDBj 6e-14 28.6 %
:RPS:PDB   1->206 3cmvH PDBj 2e-22 12.1 %
:RPS:SCOP  2->204 1sgwA  c.37.1.12 * 4e-22 19.3 %
:HMM:SCOP  6->206 1ii8.1 c.37.1.12 * 5e-54 38.9 %
:RPS:PFM   29->61 PF03193 * DUF258 4e-04 45.5 %
:HMM:PFM   43->157 PF00005 * ABC_tran 1.3e-18 33.7 104/118  
:HMM:PFM   4->61 PF03193 * DUF258 1.5e-07 24.6 57/161  
:BLT:SWISS 5->206 Y348_CHLPN 4e-25 31.2 %
:PROS 130->144|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53004.1 GT:GENE BAF53004.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 50428..51087 GB:FROM 50428 GB:TO 51087 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53004.1 LENGTH 219 SQ:AASEQ MAELSVRNLTCTYGNHIALNNITARFPTGKITALIGSNGSGKSTLLETLAGTLQPRSGSINNLAPDIAFVPQRSHVSHNLPITIRQTVSMGRWSAKKNWQRLTAADRNIVDSCLDRLEISGLADRPLGEVSGGQRQRALIAQGLAQQAPLLLLDEPLAAVDSHAASLIEDVINQQRNQGTTIILATHDLDQAHQADQIIALEKGIIKPQRKATESIKKR GT:EXON 1|1-219:0| BL:SWS:NREP 1 BL:SWS:REP 5->206|Y348_CHLPN|4e-25|31.2|202/259| PROS 130->144|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 134->159|qrqraliaqglaqqaplllldeplaa| BL:PDB:NREP 1 BL:PDB:REP 1->206|2it1A|6e-14|28.6|203/362| RP:PDB:NREP 1 RP:PDB:REP 1->206|3cmvH|2e-22|12.1|206/1173| RP:PFM:NREP 1 RP:PFM:REP 29->61|PF03193|4e-04|45.5|33/160|DUF258| HM:PFM:NREP 2 HM:PFM:REP 43->157|PF00005|1.3e-18|33.7|104/118|ABC_tran| HM:PFM:REP 4->61|PF03193|1.5e-07|24.6|57/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0003924|"GO:GTPase activity"|PF03193|IPR004881| GO:PFM GO:0005525|"GO:GTP binding"|PF03193|IPR004881| RP:SCP:NREP 1 RP:SCP:REP 2->204|1sgwA|4e-22|19.3|197/200|c.37.1.12| HM:SCP:REP 6->206|1ii8.1|5e-54|38.9|198/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 4609 OP:NHOMOORG 970 OP:PATTERN 11-23112----1---2----12674555597312231212--6354F57G92112334421213-22 -332BAA7CCCEB831133-33114B33333495459E9939475994B631A55667224697DC698D41222543415111-113332212341---1422322132122212211111112353242223-248876333D354454476633324332A722B9433332322333338451-55-365AAAAA9796B989A98999779B8657C858778787CG44444453554445564444651155255245523B8522232234677675755599989989888433334444443354566655544785A8889AA84A45655543345373B6564FE63463515424326454481113323464HC975FBB8999A9897A9A9F-469557546A53GAAADIAJLGGF9A2365796776A683333333322321346--1-------11111111111-11-1-1121-233795568578776233355B844333375F36462345333246766672333-21294334434333225325A232224372241423213267332233683342222222--1-------3111133577-C334-24-3433247433413434421-32331-1-111G6782D87989799B66-9785A8A6969A9777776CCCBC8777767677777877778D668676761888898887898114-----------486C5445952364333382233222354423423554656654-989-1----1-13866646446978763311111-------1-1122-1----------6142232--1---111111---111---2343232333122 ----23--221----1---1------1--111111--2111-----1-11--2--1--1------------------------------11--2-1---1--1-1--2---234745212216-6621-372-11422--22331131-15--D272261--12211-11C4131-11-------2--2-5-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,219-220| PSIPRED ccEEEEEEEEEEEccEEEEEEEEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEEEEEcccccccccccccHHHHHHcccHHHHHHcccccHHHHHHHHHHHHHcccHHHHcccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHccEEEEEEccEEEEEEcHHHHHHcc //