[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53009.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  25/68 : Bacteria  616/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
b.62.1
:190 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->189 1w74A PDBj 5e-68 79.9 %
:RPS:PDB   24->188 1c5fK PDBj 1e-36 38.4 %
:RPS:SCOP  24->188 1a33A  b.62.1.1 * 3e-35 37.7 %
:HMM:SCOP  19->189 1w74A_ b.62.1.1 * 2.9e-60 50.9 %
:RPS:PFM   26->185 PF00160 * Pro_isomerase 6e-30 52.1 %
:HMM:PFM   25->188 PF00160 * Pro_isomerase 3.4e-47 47.6 145/155  
:BLT:SWISS 21->189 PPIA_MYCTU 2e-67 79.9 %
:PROS 73->90|PS00170|CSA_PPIASE_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53009.1 GT:GENE BAF53009.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 54774..55346 GB:FROM 54774 GB:TO 55346 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53009.1 LENGTH 190 SQ:AASEQ MGHVVGISLDVVMMGVMTSKTATAILHTNRGDITIDLFGNHAPETVANFVGLAQGTKEYQAQNAQGDSEGPFYNGSVFHRVIDGFMIQGGDPTGTGRGGPGYTFADEFHPELRFDRAYLLAMANAGPGTNGSQFFITVTPTPHLNNAHTIFGEVTDAESQKVVDAIATTATDRYDRPADAVVIESVEITA GT:EXON 1|1-190:0| BL:SWS:NREP 1 BL:SWS:REP 21->189|PPIA_MYCTU|2e-67|79.9|169/182| PROS 73->90|PS00170|CSA_PPIASE_1|PDOC00154| SEG 89->101|ggdptgtgrggpg| BL:PDB:NREP 1 BL:PDB:REP 21->189|1w74A|5e-68|79.9|169/171| RP:PDB:NREP 1 RP:PDB:REP 24->188|1c5fK|1e-36|38.4|159/175| RP:PFM:NREP 1 RP:PFM:REP 26->185|PF00160|6e-30|52.1|142/151|Pro_isomerase| HM:PFM:NREP 1 HM:PFM:REP 25->188|PF00160|3.4e-47|47.6|145/155|Pro_isomerase| GO:PFM:NREP 2 GO:PFM GO:0003755|"GO:peptidyl-prolyl cis-trans isomerase activity"|PF00160|IPR002130| GO:PFM GO:0006457|"GO:protein folding"|PF00160|IPR002130| RP:SCP:NREP 1 RP:SCP:REP 24->188|1a33A|3e-35|37.7|159/174|b.62.1.1| HM:SCP:REP 19->189|1w74A_|2.9e-60|50.9|171/0|b.62.1.1|1/1|Cyclophilin-like| OP:NHOMO 3473 OP:NHOMOORG 838 OP:PATTERN ------------------------11111111111------2-2211111111--------1----22 2232321211111111112-11111211111111113111111112111111111111--1111321132211111111------1-------------123322-2121--------------1---------1-222221112-1--111-111111111111----11111-11111111333-----111111111111111111211111111-11221111111133111111111111111111112111111111111111111111-11122212221212222222222212222222222221222222222-211211111112122111122211111221211111-1---------221-3-----------111--1-1--1-------------------1--------------------1---------------------1--1---------11-------------------------111111111111222211-2222222111111122222-11111---11221221222-------1112221-1-1-1111----1111-221-2222242112111111111111111111122-12111111-11111121111-11111111-111---21---------11111111111111-11-1111111111111111111111211111111111111111111111111111-111111111111---2-----11111-1-21111-2111111--111111121111111112111122221-11----------111------22111111111111111111--1222222---1-111112------------------------------------22 75669AB-M8A2ACDABA9899999A78888786865876877876A89989996997998887766556556566655665565598-BHCB9CACBBBA98DCF28TCcOKKHNJ76EA7E9RO7lAo*Z1NPi8B87I9AHH9D9AEF9AM7GEFFFJOGEHA6DAEMHGGD3IJH*EEFDFTFPYBKGFFFDEAQ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 183 STR:RPRED 96.3 SQ:SECSTR #######ccccEEHHHHHHccEEEETTEEEEEEEEEEcTTTcHHHHHHHHHHHHTTTcccccTccccccccccTTccccEEETTTEEEEccTTTccccccccTTccccccccccccccEEEEccccTTcccccEEEEccccGGGTTTccEEEEEEGHEcHHHHHHHHTccccTTccccccEEEEEEEEEE DISOP:02AL 1-1,172-173| PSIPRED ccEEEHHHHHHHcccccccccEEEEEEEcccEEEEEEcccccccHHHHHHHHHcccccccccccccccccccccccEEEEEEcccEEEEcccccccccccccccccHHcccccccccEEEEEEcccccccccEEEEEEccccccccccEEEEEEEccccHHHHHHHHHccccccccccccEEEEEEEEEc //