[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53013.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:51 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->48 PF07302 * AroM 0.00036 24.4 41/221  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53013.1 GT:GENE BAF53013.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(58879..59034) GB:FROM 58879 GB:TO 59034 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53013.1 LENGTH 51 SQ:AASEQ MSMKSFQTLAQQAKQSWSDDTVAVDDAAASPYAADSNTRVHLGRTLAEAHT GT:EXON 1|1-51:0| SEG 19->36|ddtvavddaaaspyaads| HM:PFM:NREP 1 HM:PFM:REP 8->48|PF07302|0.00036|24.4|41/221|AroM| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10,48-52| PSIPRED ccHHHHHHHHHHHHHHcccccEEEccccccccccccccEEEEHHHHHHHcc //