[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53026.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  56/68 : Bacteria  879/915 : Eukaryota  194/199 : Viruses  1/175   --->[See Alignment]
c.2.1
:279 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->272 1nffA PDBj 2e-62 47.9 %
:RPS:PDB   34->271 2ae1A PDBj 2e-50 26.5 %
:RPS:SCOP  40->268 1pwxA  c.2.1.2 * 6e-53 21.8 %
:HMM:SCOP  33->268 1zemA1 c.2.1.2 * 2.8e-84 44.3 %
:RPS:PFM   38->203 PF00106 * adh_short 2e-27 42.8 %
:HMM:PFM   38->201 PF00106 * adh_short 2.1e-34 23.8 160/167  
:BLT:SWISS 34->272 HSD_MYCTU 2e-61 47.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53026.1 GT:GENE BAF53026.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 75667..76506 GB:FROM 75667 GB:TO 76506 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53026.1 LENGTH 279 SQ:AASEQ MEQSVPLNGFLFGGWRFSYGLMGILRLMTHTTKRVEGKVAFITGAASGMGASHARVLAAHGAKVVITDLNDELGQELVKEIGEEKAHYVHLNVTSFEEWEVAVQKALERFGKIDTLINNAGIFSSGSVEDATAADWDKTIAIDLNGTFYGMKAALPALKENPTASIINISSIAGVTGFKNRAAYSAAKWGVQGLTKTSAMDLGKYNIRVNSVHPGSVETPLTANLKRGLGQIPLGRAAQVEEISNLILYLSSDESSFVTGSSFVIDGGETAGNNLRDDQ GT:EXON 1|1-279:0| BL:SWS:NREP 1 BL:SWS:REP 34->272|HSD_MYCTU|2e-61|47.9|238/260| BL:PDB:NREP 1 BL:PDB:REP 34->272|1nffA|2e-62|47.9|238/244| RP:PDB:NREP 1 RP:PDB:REP 34->271|2ae1A|2e-50|26.5|238/252| RP:PFM:NREP 1 RP:PFM:REP 38->203|PF00106|2e-27|42.8|166/169|adh_short| HM:PFM:NREP 1 HM:PFM:REP 38->201|PF00106|2.1e-34|23.8|160/167|adh_short| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00106|IPR002198| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00106|IPR002198| RP:SCP:NREP 1 RP:SCP:REP 40->268|1pwxA|6e-53|21.8|225/252|c.2.1.2| HM:SCP:REP 33->268|1zemA1|2.8e-84|44.3|235/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 21705 OP:NHOMOORG 1130 OP:PATTERN 2221246BB9B9A99819354321E66A8B7E22---------21154--622-34223243953146 MMf6*41899H8A2x**YY-Y*55z*YXYYYn****x***5*G*ZMIB6GC3WNPC5H11QPh5UNkkpYE21114231299a11544789728331--B6b6JG*EhBP111111121111114877CE966BB8JLLOO222OFMFKLBAA8844221845493HNHfA234244343334MEBBC871JBRIIJIJMILILLKLLKRJQQJRKLLCIJROJEBAAAB9OnA77777657777776EBBEDA2D3BD37-31DH669999A9AE97777777674444444445444457667778777763544425559535AD55544445478566279663411B8322B7123325333366534G2KvOOc23313XE*ww8AEmXggYOQQPNOQOQQc-QTdOMuOag*o2*vvU*r******djLVITWbUNSWOMSCCCCCCCCXVVG9DIE33212222121322443342333232123DQ**TBNshVo******YWWXStt**aZZZBX*i*g**r49XXQPFNNMdQjT*t9LC7A7DI9454333369CPNAAVAI522213533426A86G73A5DHFFVc34455536644744544444447454688DCAEJKGCRI9ADCBFAFEDBBAFAFCB9G1-4366B111111ELKN8OAFIIFFEEEGG-IGGHHDEFHFIEHFFFGFFTaTLCDEDC9ABBCCBCCBABABCYEEBEDCE51BCCCCCCBCCCB111967566GGGG4LPQN333949333334573UVUZWENBICUCeeYbOYgnSSQZUQXTUA676686664777I87887FF9ACNNONQMKDEG96763366HH8799--------2-4----2-1-3-1------3-------45421666765C4 1122iXO-944-8DI***u*x*r****WYLQQSSRPSaSUOWVQNOshv*****lpmTVVSUFCP79A4F66ICK55456AHHGIH5E-j*W*PpOIHIGIEOXQO-QYH*w*ebkQG9JAMYGoc9cG**i-dcpHIKGfGPfSCKECFY99WOTMhtz*jI*ldXWShwVhld8ID6*454HaQli*w*UJImPYRI --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 272 STR:RPRED 97.5 SQ:SECSTR ######EEccccccccccTTTTTcccGccGGGGccTTcEEEEETcccHHHHHHHHHHHTTTcEEEEEEccHHHHHHHHHHHHHTcEEEEEccTTcHHHHHHHHHHHHHHTTTcccEEEEccccccccGGGccHHHHHHHHHHHTHHHHHHHHHHHHHHHTTccEEEEEEccGGGTcccTTcHHHHHHHHHHHHHHHHHHHHTGGGTEEEEEEEEcccccccHHHHHHHHHTccccccccHHHHHHHHHHHHcGGGTTccccEEEEcTTGGGcccTTcH# DISOP:02AL 1-3,25-34,273-280| PSIPRED cccccccccHHHccHHHHHHHHHHHHHcccccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHccEEEEEcccccHHHHHHHHHHHHHHHccccEEEEcccccccccHHHccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEcccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHcHHHccccccEEEEcccccccccccccc //