[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53031.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:145 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  2->31 1fohA3  c.47.1.10 * 1e-04 33.3 %
:HMM:PFM   2->32 PF07976 * Phe_hydrox_dim 8.6e-06 32.3 31/169  
:HMM:PFM   35->83 PF11855 * DUF3375 0.00071 18.4 49/478  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53031.1 GT:GENE BAF53031.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 82192..82629 GB:FROM 82192 GB:TO 82629 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53031.1 LENGTH 145 SQ:AASEQ MGRRFKSDIALRRCDAVTTHIGHEHSADGGWKKAKTHHSTASLQKTATATQSSISRPSTSSITTPSTCSMRQRSSSHELDHTSCKTSKTSGPHWIPRTSSSPVASAAMAQLLSFAQTSTSQQSSRLRTLPDWPSSSMAICLSHKP GT:EXON 1|1-145:0| SEG 50->69|tqssisrpstssittpstcs| SEG 110->129|qllsfaqtstsqqssrlrtl| HM:PFM:NREP 2 HM:PFM:REP 2->32|PF07976|8.6e-06|32.3|31/169|Phe_hydrox_dim| HM:PFM:REP 35->83|PF11855|0.00071|18.4|49/478|DUF3375| RP:SCP:NREP 1 RP:SCP:REP 2->31|1fohA3|1e-04|33.3|30/201|c.47.1.10| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,52-84,116-127,145-146| PSIPRED ccHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccHHHHcccccccccHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEcccc //