[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53035.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  133/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.46.1
:197 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->80 1yt8A PDBj 1e-07 33.8 %
:RPS:PDB   7->110 3d1pA PDBj 7e-20 26.2 %
:RPS:SCOP  1->114 1qxnA  c.46.1.3 * 1e-23 17.5 %
:HMM:SCOP  4->159 1yt8A3 c.46.1.2 * 1.1e-29 26.1 %
:RPS:PFM   25->103 PF00581 * Rhodanese 2e-08 38.0 %
:HMM:PFM   12->104 PF00581 * Rhodanese 5.5e-18 39.1 92/113  
:HMM:PFM   117->177 PF11127 * DUF2892 1.9e-11 26.8 56/66  
:BLT:SWISS 7->177 YGAP_ECOLI 5e-14 40.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53035.1 GT:GENE BAF53035.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(85285..85878) GB:FROM 85285 GB:TO 85878 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53035.1 LENGTH 197 SQ:AASEQ MTSTQPITSVDAQTLKSWIDKREGLTIIDVRTSHEFSNLHIRGSYNVPLTTLAEHSEEIASRVGEHVVLVCQSGIRAGQAQQKLAPLGISTVAVLEGGINSFAKTDGDVVRGTQVWDIERQVRFAAGSLVLAGLAGGKFLSPKVRALSGIIGAGLTFSGVSNTCAMGKALSALPWNKTKPVPTKAETLSKLPSPKEN GT:EXON 1|1-197:0| BL:SWS:NREP 1 BL:SWS:REP 7->177|YGAP_ECOLI|5e-14|40.0|165/174| SEG 125->137|aagslvlaglagg| BL:PDB:NREP 1 BL:PDB:REP 7->80|1yt8A|1e-07|33.8|74/521| RP:PDB:NREP 1 RP:PDB:REP 7->110|3d1pA|7e-20|26.2|103/118| RP:PFM:NREP 1 RP:PFM:REP 25->103|PF00581|2e-08|38.0|79/108|Rhodanese| HM:PFM:NREP 2 HM:PFM:REP 12->104|PF00581|5.5e-18|39.1|92/113|Rhodanese| HM:PFM:REP 117->177|PF11127|1.9e-11|26.8|56/66|DUF2892| RP:SCP:NREP 1 RP:SCP:REP 1->114|1qxnA|1e-23|17.5|114/137|c.46.1.3| HM:SCP:REP 4->159|1yt8A3|1.1e-29|26.1|153/0|c.46.1.2|1/1|Rhodanese/Cell cycle control phosphatase| OP:NHOMO 139 OP:NHOMOORG 135 OP:PATTERN -------------------------------------------------------------1------ -1-----2111----------1---1------2111-------1---1----111-1---11----2-121-------------------------------------------------------------------------1-111----1111------111-11------------------------1111-1111-1-111-----1-1-1111--1-------1-----------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------1---------------1-----------------------------------------------------------1---1----------------------------1---------------------1---------------------------1-----------1-----------1--------------------------1-1--1-1--1------------1-1-----------------1---11-1111111111-1111111111111111111111-----1---1111111111-1-1111111-----------------1-----------1-1-----1--------------------1----------------------------------------1------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 121 STR:RPRED 61.4 SQ:SECSTR cGGcTTcEEccHHHHHHHHHTcTTEEEEEcccHHHHHHcccTTcEEccTTTcTTGGGccHHHHTcEEEEEccccHHHHHHHHHHHTTTcccEEEEcTTHHHHHHTTGGGcEccccccTTcG############################################################################ DISOP:02AL 1-4,190-190,193-198| PSIPRED cccccccEEEcHHHHHHHHHccccEEEEEcccHHHHHHccccccEEccHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHcccccEEEEcccHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccHHHHHHHccccccc //