[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53044.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  161/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:230 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   20->210 PF04973 * NMN_transporter 5e-23 41.8 %
:HMM:PFM   21->212 PF04973 * NMN_transporter 1.4e-38 32.8 177/182  
:BLT:SWISS 7->222 PNUC_SHIFL 2e-13 27.1 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53044.1 GT:GENE BAF53044.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(94162..94854) GB:FROM 94162 GB:TO 94854 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53044.1 LENGTH 230 SQ:AASEQ MNPITELLDATLWIGGVPILWREIIGNVFGLFSAWAGMRRIVWAWPIGIIGNALLFTVFMGGLFHTPQNLDLYGQAGRQIMFIIVSGYGWYQWSAAKRRALTPENAVAVVPRWASTKERAGIVIAAVVGTLSFAWIFQALGSWGPWADAWIFVGSILATYGMARGWTEFWLIWIAVDLVGVPLLLTAGYYPSAVLYLVYGAFVSWGFVVWLRVQKTDKARALEAQESVTV GT:EXON 1|1-230:0| BL:SWS:NREP 1 BL:SWS:REP 7->222|PNUC_SHIFL|2e-13|27.1|203/239| TM:NTM 6 TM:REGION 10->32| TM:REGION 43->65| TM:REGION 121->143| TM:REGION 149->164| TM:REGION 170->187| TM:REGION 193->213| RP:PFM:NREP 1 RP:PFM:REP 20->210|PF04973|5e-23|41.8|177/182|NMN_transporter| HM:PFM:NREP 1 HM:PFM:REP 21->212|PF04973|1.4e-38|32.8|177/182|NMN_transporter| GO:PFM:NREP 2 GO:PFM GO:0006810|"GO:transport"|PF04973|IPR006419| GO:PFM GO:0016020|"GO:membrane"|PF04973|IPR006419| OP:NHOMO 173 OP:NHOMOORG 161 OP:PATTERN -------------------------------------------------------------------- ----1-1111111-1----------------------1--------11-11-121111--11-11-11111-----------------1111-111---1--1112-1-1----------------------------------1------------------------1--------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------1----------------------1-----------------------------------1--1--------1-------11--------11-----------1-------1---------------------------------1---------------------------------------------1---1-1-1--11--------1----1----11-------------111---11112122211-111112111112111111211111----1-1-1-1-1-1-11-11111111--111111111111----11111------1-----------------11111-------------11-111-1111-----1---1--------------221--------------------------------------------------------------------2- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 98-107,217-225,227-227,229-231| PSIPRED ccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHcccc //