[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53062.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:277 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53062.1 GT:GENE BAF53062.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 117791..118624 GB:FROM 117791 GB:TO 118624 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53062.1 LENGTH 277 SQ:AASEQ MNNVQQFHRFFDDSAVYYPCFVPLDRAIGEHFDRQNKPMSRFIGTLILPLAKLEEAAQYTGDEVLRVSAVISTDELADLRRDFYELPNIDIASVEIKLVGAALTNTAWLGDVEKLIQQHRNTFVWVEIPTALVTADIVRKLRHMGAGLKYRTGGDREELFPTPQDLITVLRTAIDAALPFKLTAGLHRALRYRDEKTGRLHFGFLNIAATVATLRAGKGEAEALSVLEGDDAAPLIHALQIGGNWRDSFRSFSTCNVVEPLNTLIDLDVLAEGDVHP GT:EXON 1|1-277:0| OP:NHOMO 19 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ----1---111---1----------------------111---1----------------111-132-----------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,274-278| PSIPRED cccHHHHHHHHcccccEEEEHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEccHHHHHHHHHHHHcccccEEEEEEEEEEEHHcccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHccccEEEcccccHHHcccHHHHHHHHHHHHccccccEEccccHHHHHcccccccEEEEEHHHHHHHHHHHHcccccHHHHHHHcccccHHHHHHHHHcccHHHHHHccccccHHHHHHHHEEHHHcccccccc //