[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53066.1
DDBJ      :             hypothetical protein
Swiss-Prot:URE1_CORGL   RecName: Full=Urease subunit alpha;         EC=3.5.1.5;AltName: Full=Urea amidohydrolase subunit alpha;

Homologs  Archaea  6/68 : Bacteria  321/915 : Eukaryota  90/199 : Viruses  0/175   --->[See Alignment]
b.92.1c.1.9
:570 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->570 1ubpC PDBj 0.0 58.8 %
:RPS:PDB   4->570 1a5kC PDBj e-118 61.2 %
:RPS:SCOP  4->152 1a5kC1  b.92.1.1 * 1e-31 52.4 %
:RPS:SCOP  133->570 1a5kC2  c.1.9.2 * e-114 61.0 %
:HMM:SCOP  2->182 1e9yB1 b.92.1.1 * 4.8e-54 48.0 %
:HMM:SCOP  132->570 4ubpC2 c.1.9.2 * 1.4e-188 64.5 %
:RPS:PFM   4->122 PF00449 * Urease_alpha 7e-35 58.5 %
:RPS:PFM   229->305 PF04452 * Methyltrans_RNA 6e-04 25.7 %
:RPS:PFM   411->439 PF01979 * Amidohydro_1 3e-04 62.1 %
:HMM:PFM   128->439 PF01979 * Amidohydro_1 9.1e-61 26.4 288/328  
:HMM:PFM   4->122 PF00449 * Urease_alpha 7.6e-53 59.3 118/121  
:BLT:SWISS 1->570 URE1_CORGL 0.0 100.0 %
:PROS 221->236|PS00024|HEMOPEXIN
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53066.1 GT:GENE BAF53066.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 120155..121867 GB:FROM 120155 GB:TO 121867 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53066.1 LENGTH 570 SQ:AASEQ MSFEISRKQYTDLYGPTVGDSVRLADTELFLCVEKDYAAIGEEVAFGGGKVIRDGMGQNGTLVRDVDIPDTVITNVIVLDYTGVYKADVALRDGKIFRIGKAGNPNVMENVDIVIGVATDIIAGEGKILTAGGIDTHVHFLGTDQVNTALASGITTMIGGGTGPSQASMATTVTPGQWNTYNMLSAFEGMPMNFGILGKGHGSSKSPLAEQVRAGAIGLKIHEDWGATPSSINTALEVADDMDIQVALHSDTLNEAGFVEDTIEAIAGRVIHTFHTEGAGGGHAPDLIRVAALPNVLPASTNPTLPYTRNTVEEHLDMVMVAHHLNPDIPEDVAFADSRIRAETIAAEDVLHDMGIFSITSSDSQAMGRVGETITRTWQVADHMKRTRGSLTGDAPYNDNNRLRRFIAKYTINPAIAHGVDYVVGSVEEGKFADLVLWDPKFFGVKPDLVIKGGLMVNSLMGDSNGSIPTPQPRTLRNTWGAFGQAVSRSSITFLSQDAIDANVPDLLNLRKQIRGVRGVRNLTKRDMKLNAEMPDIRVDPETYQVFVNGELITSKPAETVPMARRYFLF GT:EXON 1|1-570:0| SW:ID URE1_CORGL SW:DE RecName: Full=Urease subunit alpha; EC=3.5.1.5;AltName: Full=Urea amidohydrolase subunit alpha; SW:GN Name=ureC; OrderedLocusNames=Cgl0086, cg0115; SW:KW Complete proteome; Cytoplasm; Hydrolase; Metal-binding; Nickel. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->570|URE1_CORGL|0.0|100.0|570/570| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| PROS 221->236|PS00024|HEMOPEXIN|PDOC00023| SEG 153->163|gittmigggtg| BL:PDB:NREP 1 BL:PDB:REP 4->570|1ubpC|0.0|58.8|566/569| RP:PDB:NREP 1 RP:PDB:REP 4->570|1a5kC|e-118|61.2|565/566| RP:PFM:NREP 3 RP:PFM:REP 4->122|PF00449|7e-35|58.5|118/119|Urease_alpha| RP:PFM:REP 229->305|PF04452|6e-04|25.7|74/225|Methyltrans_RNA| RP:PFM:REP 411->439|PF01979|3e-04|62.1|29/271|Amidohydro_1| HM:PFM:NREP 2 HM:PFM:REP 128->439|PF01979|9.1e-61|26.4|288/328|Amidohydro_1| HM:PFM:REP 4->122|PF00449|7.6e-53|59.3|118/121|Urease_alpha| GO:PFM:NREP 6 GO:PFM GO:0009039|"GO:urease activity"|PF00449|IPR011612| GO:PFM GO:0016151|"GO:nickel ion binding"|PF00449|IPR011612| GO:PFM GO:0019627|"GO:urea metabolic process"|PF00449|IPR011612| GO:PFM GO:0006364|"GO:rRNA processing"|PF04452|IPR006700| GO:PFM GO:0008168|"GO:methyltransferase activity"|PF04452|IPR006700| GO:PFM GO:0016787|"GO:hydrolase activity"|PF01979|IPR006680| RP:SCP:NREP 2 RP:SCP:REP 4->152|1a5kC1|1e-31|52.4|147/181|b.92.1.1| RP:SCP:REP 133->570|1a5kC2|e-114|61.0|385/385|c.1.9.2| HM:SCP:REP 2->182|1e9yB1|4.8e-54|48.0|179/0|b.92.1.1|1/2|Composite domain of metallo-dependent hydrolases| HM:SCP:REP 132->570|4ubpC2|1.4e-188|64.5|391/391|c.1.9.2|1/1|Metallo-dependent hydrolases| OP:NHOMO 483 OP:NHOMOORG 417 OP:PATTERN ------1--------1--------1---1--1----------------------------------1- ----1--1111-111--11-12--1211111111111211-1111-1-----11111-------1-3223-----1----------------1--------1---11-------------------------------------111-11--111--1111-1111-111111-11111-1-1--1-------1------1---------1---1----1-1----------1-11111111111111111-1---------------------------------------------------------------111---------------------------1-11-------------------1---------------11133---1111122222222222-3413313211--111111111111111--111111111111111111----1---------------------------------------111-1111111111111211111111111111-1111111--111111-11-1-1-1---------1-11--------------------------11-1--1----------211111111---------1111---11-------1--------------11-1------1---11--12--------1---------1--------111--111--------------------------11111111111111------------1111111----1111----1121111-2-1-11111111111111112-----------11---------------------------1----------------------------------------111-----------1- -------------2111111121111111111111111111111111111211211111111------------------------11-12111211111121221--2-3----------------------------------------------------21--------2-----8111--1-111111111113 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 570 STR:RPRED 100.0 SQ:SECSTR EEccccHHHHHHHHcccTTcEEEcTTcccEEEccEEcccTTccccccTTcccccTTTcccccGcGGGcccEEEEEEEEEETTEEEEEEEEEETTEEEEEEcEEcTTTcccccEEccTTcEEEEcTTcEEEEcEEEEEEEcccTTHHHHHHHHTEEEEEEEcccccHHHHHcccccHHHHHHHHHHHHTTcccEEEEEEEcccccHHHHHHHHHHTccEEEEEGGGcccHHHHHHHHHHHHHHTcEEEEEccTTcccccHHHHHHHHTTccEEETTTTcTTcccTTTGGGGGGcTTEEEEEEGGGccccTTHHHHHHHHHHHHHTccTTcHHHHHTTTTTccHHHHHHHHHHHHTTcccEEEccTTccccTTcHHHHHHHHHHHHHHHHcccTTccccccHHHHHHHHHTTTHHHHHHTTcTTTcccccTTccccEEEEcGGGTTTcccEEEETTEEEEEEEccTTcccccccccEEEEcGGGcHHHHHHHcEEEEcHHHHHHTHHHHTTcccEEEEcccTTTccGGGcTTccccccEEEcTTTccEEETTEEccccccccccccTTTccc DISOP:02AL 1-2,57-65| PSIPRED ccEEEcHHHHHHHHccccccEEEEcccccEEEEEccccccccEEEEccccEEccccccccccccccccccEEEEccEEEcccccEEEEEEEEccEEEEEEcccccccccccccccccccEEEEccccEEEEcEEEEEEEEEccccHHHHHHcccEEEEEcccccccccccccccccHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHccEEEEEEEccccccHHHHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHccEEEcEEEcccccccccHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHcHHEEEEccHHHccccccEEEEHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcccHHHHcccHHHHcccccccEEEEEEEccHHccccHHHEEEccEEEEEcccccccccccccccccccHHHHccccccccEEEEEEHHHHHccHHHHHcccccEEEEcccccccHHHHHccccccccEEcccEEEEEEccEEEEcccccccccccccccc //