[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53083.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  846/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:240 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->237 2oqrA PDBj 4e-36 37.8 %
:RPS:PDB   14->235 3c3wB PDBj 9e-24 17.2 %
:RPS:SCOP  14->129 1a0oA  c.23.1.1 * 6e-21 23.3 %
:RPS:SCOP  135->236 1ys6A1  a.4.6.1 * 1e-23 38.6 %
:HMM:SCOP  10->203 1s8nA_ c.23.1.1 * 1.2e-39 31.2 %
:RPS:PFM   15->123 PF00072 * Response_reg 3e-09 29.4 %
:RPS:PFM   164->237 PF00486 * Trans_reg_C 6e-14 50.0 %
:HMM:PFM   15->123 PF00072 * Response_reg 2.5e-29 35.8 109/112  
:HMM:PFM   162->236 PF00486 * Trans_reg_C 2.4e-27 46.7 75/77  
:BLT:SWISS 14->240 PHOP_BACSU 3e-40 39.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53083.1 GT:GENE BAF53083.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 142272..142994 GB:FROM 142272 GB:TO 142994 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53083.1 LENGTH 240 SQ:AASEQ MADRTPTTATPPGRVLVVDDEQPLAQMVASYLIRAGFDTRQAHTGTQAVDEARRFSPDVVVLDLGLPELDGLEVCRRIRTFSDCYILMLTARGSEDDKISGLTLGADDYITKPFSVRELVTRVHAVLRRPRTSTTPPQVTTPLIVGDLILDPVAHQVWVGETTVELTRTEFELLVALALRPGQVLTRHDLVTEVWDTTWVGDERIVDVHIGNLRRKLGTDTRGRGFIDTVRGVGYRVGQP GT:EXON 1|1-240:0| BL:SWS:NREP 1 BL:SWS:REP 14->240|PHOP_BACSU|3e-40|39.2|227/240| SEG 57->74|pdvvvldlglpeldglev| BL:PDB:NREP 1 BL:PDB:REP 15->237|2oqrA|4e-36|37.8|222/226| RP:PDB:NREP 1 RP:PDB:REP 14->235|3c3wB|9e-24|17.2|204/210| RP:PFM:NREP 2 RP:PFM:REP 15->123|PF00072|3e-09|29.4|109/111|Response_reg| RP:PFM:REP 164->237|PF00486|6e-14|50.0|74/77|Trans_reg_C| HM:PFM:NREP 2 HM:PFM:REP 15->123|PF00072|2.5e-29|35.8|109/112|Response_reg| HM:PFM:REP 162->236|PF00486|2.4e-27|46.7|75/77|Trans_reg_C| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00486|IPR001867| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00486|IPR001867| GO:PFM GO:0003677|"GO:DNA binding"|PF00486|IPR001867| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00486|IPR001867| RP:SCP:NREP 2 RP:SCP:REP 14->129|1a0oA|6e-21|23.3|116/128|c.23.1.1| RP:SCP:REP 135->236|1ys6A1|1e-23|38.6|101/106|a.4.6.1| HM:SCP:REP 10->203|1s8nA_|1.2e-39|31.2|186/190|c.23.1.1|1/1|CheY-like| OP:NHOMO 9153 OP:NHOMOORG 857 OP:PATTERN -------------------------------------------------211---------------- 7AF7P466778655CCCBB-BH44ABBBBBB9HFHHBGGF9BBGAA688BA8BEH55811JHO6R8IQOQA444465549JB6132666675-622---22A444G4C89--------------132322215231HFFKKG7DL5NFNFFE8AA9A767999AA8BLJQ6584654574644DE75534-A5GTTUTURTUHUSWWUQFGCBBCTVb8ACS8ECA99A9AaW7AA9A99899AAA9969996B675CC655466677CC655675686DED866889988888898888555556665665588667476775RILZQQQVTUVRSKEcUU9DEBQKE8BAGM83ZUF89434546576228E64CBB955555D9LHHD8BBKBEG9989999988A-CCCCEJDE9J71LLLKHDGMMHEEDK7A7B9DE8ED9B8AAAAAAAAB9A78FD91111111111111122121111111111136CE55ADC9FNPSRVNIGGGDMMOOJHJICIVMMHKKV12IMOH8FDBQGCDJ5EKE6667A71211111752CGJ7B743231354224-C8A89A9968787EE37954653433332322222227738A66FE8BDBL7DD7IEJJGAIEHGGIHHGHKKI--23535------EECEDF9EFFFEFFGEE-FGFEEEEEEGFEEEEEEEDHFGCE887ECEEEEEEDEEDEDEEEDCCDDEE81BCCCCCCCCDCC--2A3333345448BHAK444333244443124BA89B69779D9MLOMLSRSEPRSOFIIL3212132123BBBLCCCCCFGJDELNB9E9ABBB5545--91444455--------2-2-------------------------36433454444B3 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----2-1-------1-1---------1--7-----6---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 240 STR:RPRED 100.0 SQ:SECSTR ccccccccccTHHEEEEEcccHHHHHHHHHHHHTcTTEEEEEccHHHHHHHHHHHcccEEEEccEETTEEHHHHHHHHHHcTTcEEEEGGGcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHGGGccHHHHHHGGGccGGGHHHHHHHHHHHccTTTTccHHHHHHHHHHTTTccccEEEEEccHHHHHHHHTccHHHHHHHHHHHHHHTTcccccHHHHHHHHHHTcEccTT DISOP:02AL 1-10,130-142| PSIPRED cccccccccccccEEEEEEccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHcccccEEEEEccccHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHHccccccccccccEEEEccEEEEcccEEEEEccEEEEccHHHHHHHHHHHHcccccccHHHHHHHHccccccccccEEHHHHHHHHHHcccccccccEEEEEcccEEEcccc //