[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53096.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:55 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   35->46 PF04046 * PSP 0.001 41.7 12/48  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53096.1 GT:GENE BAF53096.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 153048..153215 GB:FROM 153048 GB:TO 153215 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53096.1 LENGTH 55 SQ:AASEQ MAYLLSTIEPGTSWPRQLAELVEQFPTTEQIGIESMGLPPNWKDLTLWAQTSPPS GT:EXON 1|1-55:0| HM:PFM:NREP 1 HM:PFM:REP 35->46|PF04046|0.001|41.7|12/48|PSP| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------1--1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,54-56| PSIPRED ccHHHHHccccccHHHHHHHHHHHccccccccHHHcccccccccccccccccccc //