[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53102.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  687/915 : Eukaryota  6/199 : Viruses  11/175   --->[See Alignment]
b.71.1b.84.3
:249 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   126->239 2hsiB PDBj 3e-14 37.0 %
:RPS:PDB   126->242 2b13A PDBj 5e-24 31.6 %
:RPS:SCOP  135->241 2fhbA4  b.71.1.1 * 8e-21 8.5 %
:HMM:SCOP  74->242 1qwyA_ b.84.3.2 * 8.7e-40 37.1 %
:RPS:PFM   144->234 PF01551 * Peptidase_M23 1e-18 48.4 %
:HMM:PFM   143->238 PF01551 * Peptidase_M23 1.2e-30 44.2 95/96  
:HMM:PFM   24->93 PF10738 * Lpp-LpqN 0.00065 31.2 64/241  
:BLT:SWISS 141->238 NLPD_PSEAE 9e-17 44.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53102.1 GT:GENE BAF53102.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(156873..157622) GB:FROM 156873 GB:TO 157622 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53102.1 LENGTH 249 SQ:AASEQ MRTTTRQSTPGRHRKITASPTRKGRIALVAVAAGTISSAGAGGAAAATLQTPDETPASAESTVGDIELATSDTALSSSAVELVPQILTIAEYKPVDNLDEQLIKAVEYNNERAEAEQAARAPSVVKPTEGTFTSGYGVRWGSVHKGLDVANVVGTPILAAMGGTVIDSGPASGFGQWIRIQHDDGSIAVYGHMETLDVTVGEQVTAGQKIAGMGNRGFSTGSHLHFELYPAGSDAVDPAPWFAEHGITF GT:EXON 1|1-249:0| BL:SWS:NREP 1 BL:SWS:REP 141->238|NLPD_PSEAE|9e-17|44.8|96/297| SEG 29->48|vavaagtissagaggaaaat| SEG 68->79|latsdtalsssa| SEG 111->121|eraeaeqaara| BL:PDB:NREP 1 BL:PDB:REP 126->239|2hsiB|3e-14|37.0|108/228| RP:PDB:NREP 1 RP:PDB:REP 126->242|2b13A|5e-24|31.6|117/131| RP:PFM:NREP 1 RP:PFM:REP 144->234|PF01551|1e-18|48.4|91/96|Peptidase_M23| HM:PFM:NREP 2 HM:PFM:REP 143->238|PF01551|1.2e-30|44.2|95/96|Peptidase_M23| HM:PFM:REP 24->93|PF10738|0.00065|31.2|64/241|Lpp-LpqN| RP:SCP:NREP 1 RP:SCP:REP 135->241|2fhbA4|8e-21|8.5|106/118|b.71.1.1| HM:SCP:REP 74->242|1qwyA_|8.7e-40|37.1|167/270|b.84.3.2|1/1|Duplicated hybrid motif| OP:NHOMO 1975 OP:NHOMOORG 704 OP:PATTERN -------------------------------------------------------------------- 11--131322211111111-141121111111212267AA1--1-211-351543112--426-222775-------------2-411453435112--2222331113------------------1212231211112----32H534343433312233222456663-3-----3----31232221-2-444444433535543321111444111416521111-72---1-1--1------1----2----------------------12-111-----------------------------------------432--22222221213-11-332214-1621626535444334565531-22-433121111223333333333333333333334-333433342451433233233332325443211111111-------------33411----------2122222221221----145343344463222231233311243333342323333221113143332224422323243422222222323244332232455244453532334334444512-1222233332113111111133222115523243254253333533323323353321-1323311----44333434434444444-444444444444444444333333333333333333333333344434444314333333333332222-----2222-243212123233322333233333321113356562344533334444---------134553444434444555363333344341-346688663442422254--------------------------1111111111--- ------------------------------------------------------------------------------------------------------------2--------------------------------------------------------------------11------6--1--1------- -1--------------------------------------------------------------------------------1---------------------11--1----1--------1---1-------111-------------------------------------- STR:NPRED 127 STR:RPRED 51.0 SQ:SECSTR ##########################################################################################################################ccTccccHHHHTccEEEcccEEccEEEEccTTcEEEccccEEEEEEEEcccccEEEEEEETTcEEEEEEEEccccccTTcEEcTTcEEEEccccccccccEEEEEEEEccccEEccHHHHHcccccH DISOP:02AL 1-25,42-121| PSIPRED ccccccccccccccccccccccccEEEEEEccccHHccccccccEEcccccccccccccEEEEccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccEEEEccccccccccccEEEccccccEEEEccccEEEEEEEccccEEEEEEEccccEEEEEEEccccccccccEEEcccEEEEEEccccccccEEEEEEEEcccccccHHHHHHHccccc //