[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53106.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.1.18
:194 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   32->128 2c9rA PDBj 1e-07 24.2 %
:RPS:SCOP  35->128 1ix2A  b.1.18.17 * 7e-13 22.6 %
:HMM:SCOP  32->129 1m42A_ b.1.18.17 * 2.1e-17 32.0 %
:RPS:PFM   32->128 PF04234 * CopC 3e-10 37.5 %
:HMM:PFM   9->129 PF04234 * CopC 2.3e-28 33.9 118/121  
:HMM:PFM   163->193 PF03594 * BenE 0.00057 38.7 31/378  
:BLT:SWISS 53->128 YOBA_SHIFL 2e-04 32.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53106.1 GT:GENE BAF53106.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 161224..161808 GB:FROM 161224 GB:TO 161808 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53106.1 LENGTH 194 SQ:AASEQ MIISPMLPRRVLATVVAVGALTVVATPVALAHDSVIGGNPADGDVVEEFPRSIELEFSGLPQEGFSTVAITDQDSGDLLFSGEPTIDGRLVTLDLPADVSGGPGDYTVGFQILSSDGHATRSATTFTVAGDAQTTATPTGADAKPVEETTAVENTAEGDTSIVSNPIVLTLAGLALFGVIAGAIVLAVRNRDRR GT:EXON 1|1-194:0| BL:SWS:NREP 1 BL:SWS:REP 53->128|YOBA_SHIFL|2e-04|32.9|76/124| TM:NTM 1 TM:REGION 13->35| SEG 11->31|vlatvvavgaltvvatpvala| SEG 146->157|veettaventae| RP:PDB:NREP 1 RP:PDB:REP 32->128|2c9rA|1e-07|24.2|95/97| RP:PFM:NREP 1 RP:PFM:REP 32->128|PF04234|3e-10|37.5|96/121|CopC| HM:PFM:NREP 2 HM:PFM:REP 9->129|PF04234|2.3e-28|33.9|118/121|CopC| HM:PFM:REP 163->193|PF03594|0.00057|38.7|31/378|BenE| GO:PFM:NREP 3 GO:PFM GO:0005507|"GO:copper ion binding"|PF04234|IPR007348| GO:PFM GO:0042597|"GO:periplasmic space"|PF04234|IPR007348| GO:PFM GO:0046688|"GO:response to copper ion"|PF04234|IPR007348| RP:SCP:NREP 1 RP:SCP:REP 35->128|1ix2A|7e-13|22.6|93/102|b.1.18.17| HM:SCP:REP 32->129|1m42A_|2.1e-17|32.0|97/0|b.1.18.17|1/1|E set domains| OP:NHOMO 20 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- -----112112111-----------------------211-------1----1-----------1-1---1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 96 STR:RPRED 49.5 SQ:SECSTR ###############################cccEEEEEccTTcEEcc#cccEEEEEcccccGGGcEEEEEEEEEcccEEEcEEEEcccTTEEEEEEccccccEEEEEEEEEccTTcccEEEEEEEEE################################################################## DISOP:02AL 1-1,3-3,5-7,80-86,134-156,192-195| PSIPRED ccEEEHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccccccHHHcccEEEEEEcccccccccEEEEEEcccccccccccccccccEEEEEEcccccccccEEEEEEEEEEEcccEEEEEEEEEEccccccccccccccccccccccccccccccccccccccEEEEHHHHHHHHHHHHEEEEEEEccccc //