[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53120.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  322/915 : Eukaryota  74/199 : Viruses  0/175   --->[See Alignment]
:404 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   26->373 PF01566 * Nramp 4e-24 31.1 %
:HMM:PFM   26->373 PF01566 * Nramp 4.2e-113 47.0 345/356  
:BLT:SWISS 8->402 MNTH_MYCTU 1e-80 50.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53120.1 GT:GENE BAF53120.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(173840..175054) GB:FROM 173840 GB:TO 175054 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53120.1 LENGTH 404 SQ:AASEQ MSRQPLPWLLGPAFVAAVAYVDPGNVAANITAGAQYGYLLVWVLVVANVMAMLVQYLSAKLGLVTGYSLPELLGQRLPRGRRLMFWAQAETVAAATDLAEVIGGAIALHILFGLPLLIGGLLIGLVSMLLLAIQSRHGQHPFEFVIVGLLVIITAGFLTGMFIGTVSWGEALAGVIPRFEGTPTVVLAASMLGATVMPHAIYAHSSLARDRHGDTIAPEALPRLLRVTRWDVLLSLLVAGSVNIAMLLLAAGNLNGIPGTDSIEGAHAVITDTLGPVVGVAFGVGLLASGLASTSVGCYAGSTIMGGLLHRQIPQVVRRAVTLIPALIVIAAGVEPTWALVLSQVVLSLGIPFALIPLVVLSSDQTLMGGFAIRVPLQVASWVVVALIVSLNLALIGLLVTGRG GT:EXON 1|1-404:0| BL:SWS:NREP 1 BL:SWS:REP 8->402|MNTH_MYCTU|1e-80|50.6|395/428| TM:NTM 10 TM:REGION 3->25| TM:REGION 42->64| TM:REGION 104->126| TM:REGION 142->164| TM:REGION 172->194| TM:REGION 229->251| TM:REGION 276->298| TM:REGION 320->342| TM:REGION 348->370| TM:REGION 381->402| SEG 39->54|llvwvlvvanvmamlv| SEG 69->83|lpellgqrlprgrrl| SEG 106->131|ialhilfglplligglliglvsmlll| SEG 247->256|lllaagnlng| SEG 277->297|vvgvafgvgllasglastsvg| RP:PFM:NREP 1 RP:PFM:REP 26->373|PF01566|4e-24|31.1|344/354|Nramp| HM:PFM:NREP 1 HM:PFM:REP 26->373|PF01566|4.2e-113|47.0|345/356|Nramp| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF01566|IPR001046| GO:PFM GO:0006810|"GO:transport"|PF01566|IPR001046| GO:PFM GO:0016020|"GO:membrane"|PF01566|IPR001046| OP:NHOMO 513 OP:NHOMOORG 396 OP:PATTERN -------------------------------------------------------------------- 111--1----121-11111-111111111111-111-111----1----11121---1-----11------1111111----1----------1-----1-11--1-1-1----------------1------1--1--------1----------------------11--------------11-----1-1111111111111111--1111111---1-1-111111-1---------------111112-3-22-1--12222122121121221------1-----------------------------1------1--22----------1-------------------------1-1221---1-----------11112111111-111111111111-11111111-1--1--1--------1--------------1111111111111-------------------------------------------22232232333223323222332211------1-1---1---11-------1-----------------------1---------------------1---------------------------11-----------------------------------------11111111111111111-111111111111111111111111---1111111111111111211111111-1111111-111111--------------1----------------------------11-1-111------------------1---------1----11111111111111--------------------------------------------------------11- ----2-1-----112-1--11111111--------111111-1---1111-----1------1333111111212111111344-311----1----------34--1-------------------------------------------------------------------112-8111-23574145--2123- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,209-219| PSIPRED ccHHHHHHHHcHHHHHHHHHccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHEEcccHHHHHHHcccccccccHHHHHHHHHHcHHHHHHHHHHHHHHEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //