[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53124.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:197 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   12->197 PF03596 * Cad 3e-22 40.8 %
:HMM:PFM   13->194 PF03596 * Cad 2.2e-37 36.1 180/191  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53124.1 GT:GENE BAF53124.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 177561..178154 GB:FROM 177561 GB:TO 178154 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53124.1 LENGTH 197 SQ:AASEQ MVTGLLSAIGLFIATNIDDIIVLSLFFARGAGQKGTTLRILAGQYLGFMGILAAAVLVTLGAGAFLPAEAIPYFGLIPLALGLWAAWQAWRSDDDDDDAKIAGKKVGVLTVAGVTFANGGDNIGVYVPVFLNVDTAAVIIYCIVFLVLVAGLVLLAKFVATRPPIAEVLERWEHVLFPIVLIALGIFILVSGGAFGL GT:EXON 1|1-197:0| TM:NTM 6 TM:REGION 6->28| TM:REGION 42->64| TM:REGION 68->90| TM:REGION 106->128| TM:REGION 131->153| TM:REGION 174->196| SEG 52->66|laaavlvtlgagafl| SEG 79->90|lalglwaawqaw| SEG 93->98|dddddd| SEG 144->160|vflvlvaglvllakfva| RP:PFM:NREP 1 RP:PFM:REP 12->197|PF03596|3e-22|40.8|184/189|Cad| HM:PFM:NREP 1 HM:PFM:REP 13->194|PF03596|2.2e-37|36.1|180/191|Cad| OP:NHOMO 34 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- --------112-1--------5----------2--111---------2------3-1-----1----1---------------------------------------------------------------------------------1--1----------------1--------------------------1-11----1---1----------------------------------------1-----------------------------------------------------------------------------------1----------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 91-103,197-198| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHcccccccEEEEEEEEEEEcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHEEEEcccccc //