[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53128.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  488/915 : Eukaryota  193/199 : Viruses  0/175   --->[See Alignment]
c.1.7
:116 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->116 1vbjB PDBj 2e-26 48.1 %
:RPS:PDB   11->116 1a80A PDBj 7e-30 52.8 %
:RPS:SCOP  11->116 1a80A  c.1.7.1 * 5e-30 52.8 %
:HMM:SCOP  11->116 1ah4A_ c.1.7.1 * 3.1e-33 38.7 %
:RPS:PFM   24->116 PF00248 * Aldo_ket_red 9e-10 38.7 %
:HMM:PFM   25->116 PF00248 * Aldo_ket_red 1.5e-21 32.6 92/284  
:BLT:SWISS 12->116 Y2408_MYCS2 2e-31 57.1 %
:PROS 48->65|PS00798|ALDOKETO_REDUCTASE_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53128.1 GT:GENE BAF53128.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 182030..182380 GB:FROM 182030 GB:TO 182380 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53128.1 LENGTH 116 SQ:AASEQ MTPQSAPSHPVPTIELNNNVSMPALGFGVFQTPPADTMTAVTTALGTGYRHIDTAAAYGNEREVGQAIATSGLSRQEVFIETKVWITDYGYDKTLHAFDKSAGKLGVDTIDLLILH GT:EXON 1|1-116:0| BL:SWS:NREP 1 BL:SWS:REP 12->116|Y2408_MYCS2|2e-31|57.1|105/275| PROS 48->65|PS00798|ALDOKETO_REDUCTASE_1|PDOC00061| BL:PDB:NREP 1 BL:PDB:REP 13->116|1vbjB|2e-26|48.1|104/279| RP:PDB:NREP 1 RP:PDB:REP 11->116|1a80A|7e-30|52.8|106/277| RP:PFM:NREP 1 RP:PFM:REP 24->116|PF00248|9e-10|38.7|93/281|Aldo_ket_red| HM:PFM:NREP 1 HM:PFM:REP 25->116|PF00248|1.5e-21|32.6|92/284|Aldo_ket_red| GO:PFM:NREP 2 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00248|IPR001395| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00248|IPR001395| RP:SCP:NREP 1 RP:SCP:REP 11->116|1a80A|5e-30|52.8|106/277|c.1.7.1| HM:SCP:REP 11->116|1ah4A_|3.1e-33|38.7|106/0|c.1.7.1|1/1|NAD(P)-linked oxidoreductase| OP:NHOMO 2654 OP:NHOMOORG 693 OP:PATTERN -----------------1------61162651-----------------------------121---- -11-121244425123311-12111211111122331644-1114452-32-56511211--111-512312222332-11-------111---------1--212--1------------------------------1----1--1------------1---1-------------------1---1--1134444443423433342222323331123324444444221333333333333333222426823324324556644254255444222111113311111111111111-1111111111111111113---1211122122121-------1--1--21----------------1-11--211--------3221-12122211111111112-1121221131--222111121113-11---1-11111--111111111--11--1------------------------------2---2-22221111111----1111---1-111-1111--112--1--1------------1------------1-----------1----1--1--1--1211-1----2---------3--------------1112----1--------1-1------------1----------22111122444244433-4223443242444222223334111223133333333223233223222231-333333323333-----1-1------1-1----3-1---------1111112-111-1111122112222----------------------------21-1-11111-------611-111----------2-----------1------3--------1--21222--1 ----544-643112499A9FBCAGEGD55132378668788784559A7EACLCFG855677C4935A45449374556546677743-JQB97C87A78429C6611M2XJF667J5427D8ENK3M4Y*E1JAI6431823NI43452G1572875C65446BB5B9FEKA831322b111447CJB8DA359256B ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 100.0 SQ:SECSTR HHHHHHcccTccEEEcTTccEEEcccEEcTTccTTTHHHHHHHHHHHTccEEEccGGGTcHHHHHHHHHHccccGGGcEEEEEEcGGGccTTHHHHHHHHHHHHHTcccEEEEEEc DISOP:02AL 1-13| PSIPRED ccccccccccccEEEcccccEEccEEEEEEEccHHHHHHHHHHHHHHcccHHHHHHHHccHHHHHHHHHHccccHHHEEEEEccccccccHHHHHHHHHHHHHHccccEEEEEEEc //