[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53130.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:255 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   169->246 1v5bB PDBj 8e-05 39.7 %
:HMM:PFM   184->226 PF03170 * BcsB 0.001 24.4 41/607  
:BLT:SWISS 108->243 INVA_MAIZE 1e-04 31.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53130.1 GT:GENE BAF53130.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 183403..184170 GB:FROM 183403 GB:TO 184170 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53130.1 LENGTH 255 SQ:AASEQ MDTDDSAHMPDAVIKASRQPANIEIAHQVGEVIAHMLGDGQSVIDPTETIWTAEAAEDLRARIGDNPILGSDKGQWDKLDHQLDGAPRAVVLLAAELVFLREHALYVALPTTRLAHVERVLAHLDPPVAIKDPMATWLSRPVRTAGFDPGSWYNGALWRHLIWAATFVRHWKELPEDKRETAKNNPWAFQQVMLASGTDRSDIRNALQFLAFPQAFEPISAASMKTEIRNGLAHLIGGATGSTPAAIDSDLLAIR GT:EXON 1|1-255:0| BL:SWS:NREP 1 BL:SWS:REP 108->243|INVA_MAIZE|1e-04|31.7|126/100| SEG 89->98|avvllaaelv| BL:PDB:NREP 1 BL:PDB:REP 169->246|1v5bB|8e-05|39.7|68/357| HM:PFM:NREP 1 HM:PFM:REP 184->226|PF03170|0.001|24.4|41/607|BcsB| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ----------1-----------------------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 68 STR:RPRED 26.7 SQ:SECSTR ########################################################################################################################################################################HHHHHHHH###HHHTTcTTcEEEEEEHHHH#######HHHHHHcGGGccEEEEcHHHHHHHHHHHTTccccccccEEE######### DISOP:02AL 1-7,177-181| PSIPRED ccccccccccHHHHHcccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHcEEEEEccHHHHHHHHHHHHHcccccccccHHHHHHcccHHHccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHcHHHcccccHHHHHHHHHHHHHHHHcccccccHHHccccHHccc //