[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53142.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:113 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   33->65 1sq8A PDBj 1e-04 48.5 %
:RPS:PDB   33->87 2axvB PDBj 3e-10 18.9 %
:RPS:SCOP  33->87 1b0nA2  a.35.1.3 * 1e-09 30.9 %
:HMM:SCOP  24->92 2a6cA1 a.35.1.13 * 5.6e-13 39.1 %
:RPS:PFM   34->87 PF01381 * HTH_3 3e-05 47.2 %
:HMM:PFM   34->87 PF01381 * HTH_3 4e-16 45.3 53/55  
:BLT:SWISS 24->73 Y160_METLZ 4e-05 40.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53142.1 GT:GENE BAF53142.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(198201..198542) GB:FROM 198201 GB:TO 198542 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53142.1 LENGTH 113 SQ:AASEQ MTPLPDLHRRRPGNRENIDRIKAGMYSDAKAYRLRTLREESGLTQESLAKKIGVGQNRISQIEHGHLTSARVSTVQKYVAALGGSLELTVKRADGSTVTLPAEEDLEDLADSK GT:EXON 1|1-113:0| BL:SWS:NREP 1 BL:SWS:REP 24->73|Y160_METLZ|4e-05|40.0|50/317| BL:PDB:NREP 1 BL:PDB:REP 33->65|1sq8A|1e-04|48.5|33/64| RP:PDB:NREP 1 RP:PDB:REP 33->87|2axvB|3e-10|18.9|53/303| RP:PFM:NREP 1 RP:PFM:REP 34->87|PF01381|3e-05|47.2|53/55|HTH_3| HM:PFM:NREP 1 HM:PFM:REP 34->87|PF01381|4e-16|45.3|53/55|HTH_3| GO:PFM:NREP 1 GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01381|IPR001387| RP:SCP:NREP 1 RP:SCP:REP 33->87|1b0nA2|1e-09|30.9|55/68|a.35.1.3| HM:SCP:REP 24->92|2a6cA1|5.6e-13|39.1|69/0|a.35.1.13|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ----------1-----111-1-----11111--------------------------------------------1----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 85 STR:RPRED 75.2 SQ:SECSTR ###########################HHHHHHHHHHHHHHTccHHHHHTTHTccHHHHHHHHTTcHccccHHHHHHHHHHHTccHHHHHHHHHHHHcccccHHHHHHHHcc# DISOP:02AL 1-2,4-4,110-114| PSIPRED cccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHccccccccHHHHHHHHHHcccEEEEEEEccccccccccHHHHcccccccc //