[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53146.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  76/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->126 1f9zA PDBj 1e-06 25.2 %
:RPS:PDB   1->126 3ecjB PDBj 2e-14 15.9 %
:RPS:SCOP  1->123 1sqiA1  d.32.1.3 * 2e-16 22.0 %
:HMM:SCOP  1->127 1t47A2 d.32.1.3 * 1.7e-24 37.0 %
:RPS:PFM   2->103 PF00903 * Glyoxalase 6e-08 38.5 %
:HMM:PFM   5->124 PF00903 * Glyoxalase 1.3e-18 27.4 117/128  
:BLT:SWISS 1->126 YURT_BACSU 4e-38 56.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53146.1 GT:GENE BAF53146.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 201053..201442 GB:FROM 201053 GB:TO 201442 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53146.1 LENGTH 129 SQ:AASEQ MRIEITSVFVDDQAKALDFYTTKLGFELKNDVSAGEYRWLTVVDPENPNGVQLLLEPNQHPDATTYQAGIKRDGIPATQFFVDDLEAEFDRLKAAGVEFTMEPTDIGPSIIAMLDDTVGNLIQIVQLKK GT:EXON 1|1-129:0| BL:SWS:NREP 1 BL:SWS:REP 1->126|YURT_BACSU|4e-38|56.3|126/127| BL:PDB:NREP 1 BL:PDB:REP 1->126|1f9zA|1e-06|25.2|123/128| RP:PDB:NREP 1 RP:PDB:REP 1->126|3ecjB|2e-14|15.9|113/359| RP:PFM:NREP 1 RP:PFM:REP 2->103|PF00903|6e-08|38.5|96/120|Glyoxalase| HM:PFM:NREP 1 HM:PFM:REP 5->124|PF00903|1.3e-18|27.4|117/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 1->123|1sqiA1|2e-16|22.0|123/149|d.32.1.3| HM:SCP:REP 1->127|1t47A2|1.7e-24|37.0|127/0|d.32.1.3|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 101 OP:NHOMOORG 80 OP:PATTERN -----------------------1--------------------1-1--------------------1 -11-2---111----------2--12-----122223112-1-21-------212--2---1--2-2132----------------------------------11-1------------------------------------1---------------------------------------------------------------------1--1---1--------------------------1--11-----------------------------------------------------------------------1------1-1-1-----------------------------------------------------------------------------------1---------------------------------------------------------------------------------111--------------1-------2-1------11------1---1----------------------------------------------------1-----------------------------------------1111------1---1111-----------------------------------------------------------------------------------------------------------------1-------------------------------1----1111-----------------------1-1--11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 128 STR:RPRED 99.2 SQ:SECSTR EEEEEEEEEEccHHHHHHHHTTTTccEEEEEcccEEEEEccEcGTTccccccEEEEEccccEEcccccccccEEEEEEEccTHHHHHHHHHHHHTTccEEEETTcTTcccEEEEEcTTccEEEEEcHT# DISOP:02AL 129-130| PSIPRED ccEEEEEEEEccHHHHHHHHHHHcccEEEEEEEccccEEEEEEEcccccEEEEEEEccccccccccccccccccEEEEEEEEccHHHHHHHHHHcccEEEEccEEcccEEEEEEEcccccEEEEEEEcc //