[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53160.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.55.1
:381 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   29->170 1czaN PDBj 2e-17 11.3 %
:RPS:SCOP  22->64 1ft9A1  a.4.5.4 * 7e-06 16.3 %
:RPS:SCOP  35->81 2hoeA1  a.4.5.63 * 9e-07 34.1 %
:RPS:SCOP  90->179 2aa4A1  c.55.1.10 * 2e-06 21.2 %
:HMM:SCOP  12->82 1z6rA1 a.4.5.63 * 9.2e-09 34.3 %
:HMM:SCOP  83->204 2hoeA3 c.55.1.10 * 5.9e-15 33.1 %
:HMM:PFM   90->201 PF00480 * ROK 6.1e-08 24.3 107/179  
:HMM:PFM   26->65 PF01047 * MarR 4.6e-07 33.3 36/59  
:BLT:SWISS 1->331 Y495_MYCBO 3e-09 25.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53160.1 GT:GENE BAF53160.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(214022..215167) GB:FROM 214022 GB:TO 215167 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53160.1 LENGTH 381 SQ:AASEQ MPNQAHFSASFARPSTPAAKCMHHIRLGQQLIRNELVEATGLSQPTVTRAVTALMQAGLVRERPDLTLSSGPGRPNIPLELAPSPWIHAGVAIGTKSSYVALFDTKGRTLRDAMLEISAADLDPDTFIEHLIAGVNRLTTGLDLPLVGIGVATSGKVTNAGVVTASNLGWDGVDIAGRLNYQFSVPATVASAIPAIAASELQASPLPHPEQPTPITLTFYADDSVGAAYSNDLGVHVIGPLATTRGSGLDTLGMAAEDALSTQGFLSRVSDQGIFANSLGELVTIAKDNETARAFLNDRATLLAHTAAEAAETVKPSTLVLSGSAFSEDPQGRSVFASQLKKEYDADIELRLIPTHRENVRAAARAVALDRLLNEPLTLVP GT:EXON 1|1-381:0| BL:SWS:NREP 1 BL:SWS:REP 1->331|Y495_MYCBO|3e-09|25.6|317/438| SEG 184->198|svpatvasaipaiaa| SEG 300->313|atllahtaaeaaet| SEG 360->368|vraaarava| RP:PDB:NREP 1 RP:PDB:REP 29->170|1czaN|2e-17|11.3|142/898| HM:PFM:NREP 2 HM:PFM:REP 90->201|PF00480|6.1e-08|24.3|107/179|ROK| HM:PFM:REP 26->65|PF01047|4.6e-07|33.3|36/59|MarR| RP:SCP:NREP 3 RP:SCP:REP 22->64|1ft9A1|7e-06|16.3|43/78|a.4.5.4| RP:SCP:REP 35->81|2hoeA1|9e-07|34.1|41/58|a.4.5.63| RP:SCP:REP 90->179|2aa4A1|2e-06|21.2|85/119|c.55.1.10| HM:SCP:REP 12->82|1z6rA1|9.2e-09|34.3|70/0|a.4.5.63|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 83->204|2hoeA3|5.9e-15|33.1|121/0|c.55.1.10|1/1|Actin-like ATPase domain| OP:NHOMO 35 OP:NHOMOORG 30 OP:PATTERN -------------------------------------------------------------------- ----1111222---111----1--11-----111111212------1-1----------------11-1---111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 169 STR:RPRED 44.4 SQ:SECSTR ##############cHHHHHHHHHHHHHHHHHHHHHTGGGcccHHHHHHHHHHHHHHHHcTTTGGGcccccEEccccccccccccEEEEEEEEccccEEEEEEEEEEETTEEEEEEEEHHcccHHHHHHHHHHHHHHHHHHHTcTcEEEEEcccEEccTccEEccccTTcTTccHHHHHHHHH###################################################################################################################################################################################################### DISOP:02AL 1-16,62-77| PSIPRED cccccccccccHHHcccHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEcccccccccccccEEEEEEcccEEEEEEEEcccEEEEEEEcccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHccccEEEEEEEccEEEEcccEEEccccccccccHHHHHHHHHcccEEEEEHHHHHHHHHHHccccccccccccEEEEEEEcccEEEEEEEccEEEcccccccccccccccccccccHHcccHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcHHHccccHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHHHHHccccccc //