[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53173.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:252 amino acids
:PSIPRED
:HMM:PFM   10->240 PF01925 * TauE 6.3e-24 26.5 226/239  
:BLT:SWISS 108->214 Y093_RHIME 4e-04 34.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53173.1 GT:GENE BAF53173.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 228948..229706 GB:FROM 228948 GB:TO 229706 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53173.1 LENGTH 252 SQ:AASEQ MIVLTIAIVLLASVLIGALLQRMTGLGVGLVTGPVLTSLLGPLAGVTMVNGLSIINAVNNAWSVRKRTDWAKFRILAGALVLGSVPAVAVVYFLNGPWLLIFVGAMVLLALGVSLFPTEKFALKQEAKLPMVIFGMIGGFMSTVAGIAGPSLTVYARLSRWDYRDFVATLHPVLLVANTVSFLLKVILIGGLDFGGAPAWLWIGAVAMIFVGAWLGEIVNAKVSTPMAKRIATLLAAAGAAVVLFRGIMELV GT:EXON 1|1-252:0| BL:SWS:NREP 1 BL:SWS:REP 108->214|Y093_RHIME|4e-04|34.7|101/465| TM:NTM 8 TM:REGION 1->23| TM:REGION 32->54| TM:REGION 74->96| TM:REGION 98->119| TM:REGION 132->154| TM:REGION 170->192| TM:REGION 197->219| TM:REGION 231->252| SEG 24->41|tglgvglvtgpvltsllg| SEG 232->244|atllaaagaavvl| HM:PFM:NREP 1 HM:PFM:REP 10->240|PF01925|6.3e-24|26.5|226/239|TauE| OP:NHOMO 9 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- -----1-2111--1-----------------------------------1------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHcccccccHHHHHHHHEEEcccEEEEEEcccHHHHHHHHHHHHccccccEEEEEEcccHHHHHHHHHHHHHHHcHHHccccccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHc //