[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53177.1
DDBJ      :             hypothetical protein
Swiss-Prot:PAND_CORGL   RecName: Full=Aspartate 1-decarboxylase;         EC=4.1.1.11;AltName: Full=Aspartate alpha-decarboxylase;Contains:  RecName: Full=Aspartate 1-decarboxylase beta chain;Contains:  RecName: Full=Aspartate 1-decarboxylase alpha chain;Flags: Precursor;

Homologs  Archaea  3/68 : Bacteria  495/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.52.2
:136 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->113 2c45A PDBj 2e-34 61.9 %
:RPS:PDB   1->113 2c45A PDBj 2e-48 68.1 %
:RPS:SCOP  1->120 1uhd.1  b.52.2.1 * 2e-23 50.0 %
:HMM:SCOP  1->118 1ppyA_ b.52.2.1 * 9.4e-46 58.5 %
:RPS:PFM   1->114 PF02261 * Asp_decarbox 7e-38 65.8 %
:HMM:PFM   1->115 PF02261 * Asp_decarbox 4.4e-52 60.0 115/116  
:BLT:SWISS 1->136 PAND_CORGL 4e-73 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53177.1 GT:GENE BAF53177.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(231804..232214) GB:FROM 231804 GB:TO 232214 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53177.1 LENGTH 136 SQ:AASEQ MLRTILGSKIHRATVTQADLDYVGSVTIDADLVHAAGLIEGEKVAIVDITNGARLETYVIVGDAGTGNICINGAAAHLINPGDLVIIMSYLQATDAEAKAYEPKIVHVDADNRIVALGNDLAEALPGSGLLTSRSI GT:EXON 1|1-136:0| SW:ID PAND_CORGL SW:DE RecName: Full=Aspartate 1-decarboxylase; EC=4.1.1.11;AltName: Full=Aspartate alpha-decarboxylase;Contains: RecName: Full=Aspartate 1-decarboxylase beta chain;Contains: RecName: Full=Aspartate 1-decarboxylase alpha chain;Flags: Precursor; SW:GN Name=panD; OrderedLocusNames=Cgl0135, cg0172; SW:KW Autocatalytic cleavage; Complete proteome; Cytoplasm; Decarboxylase;Lyase; Pantothenate biosynthesis; Pyruvate; Schiff base; Zymogen. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->136|PAND_CORGL|4e-73|100.0|136/136| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016831|"GO:carboxy-lyase activity"|Decarboxylase| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| GO:SWS GO:0015940|"GO:pantothenate biosynthetic process"|Pantothenate biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 1->113|2c45A|2e-34|61.9|113/113| RP:PDB:NREP 1 RP:PDB:REP 1->113|2c45A|2e-48|68.1|113/113| RP:PFM:NREP 1 RP:PFM:REP 1->114|PF02261|7e-38|65.8|114/116|Asp_decarbox| HM:PFM:NREP 1 HM:PFM:REP 1->115|PF02261|4.4e-52|60.0|115/116|Asp_decarbox| GO:PFM:NREP 2 GO:PFM GO:0004068|"GO:aspartate 1-decarboxylase activity"|PF02261|IPR003190| GO:PFM GO:0006523|"GO:alanine biosynthetic process"|PF02261|IPR003190| RP:SCP:NREP 1 RP:SCP:REP 1->120|1uhd.1|2e-23|50.0|118/119|b.52.2.1| HM:SCP:REP 1->118|1ppyA_|9.4e-46|58.5|118/0|b.52.2.1|1/1|ADC-like| OP:NHOMO 512 OP:NHOMOORG 499 OP:PATTERN ---------------------11-----1--------------------------------------- ----1--11111-111111-111131111111111111111121--1-111-211111--111-1111111---------1--1111111111111---11111111111---------------11111111111-----1111-111-111----------11-21111------------11111---211111111111111111111111111111111111111121-11111111111111111111-----------1---------------------------------------------------------1--111111211-111-111-----11---111111211--1111-11---111111-----111---------------------------1---2---11---1------1111-----------------------11------------------------------------1111-1111111111111111111111111-1--111111-1111212-1111111111111111-----11---111-1-1----1-1---111111111111111111111-1111111111111111--1--1----1----------------------1111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111----11111111111-11---------------1111111111111111---------1---1111111111--------------1111111111111111--111111------------------------------------11-1111111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 86.8 SQ:SECSTR cEEEcccEEEEEEEcccEEcccccEEEEEHHHHHHTTccccccEEEEETTTccEEEEcEEEEcTTTTcEEEEccTTTTccTTcEEEEEEccEEEHHHHHccccEEEEccTTccEEEEE################## DISOP:02AL 132-137| PSIPRED cHHHHHHHEEcEEEEEccEEEEEEEEEEcHHHHHHcccccccEEEEEEcccccEEEEEEEEcccccEEEEEcHHHHcccccccEEEEEEEEcccHHHHHHcccEEEEEcccccEEEEccccccccccccccccccc //