[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53181.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  223/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:260 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   14->252 PF01925 * TauE 3.6e-32 26.4 231/239  
:BLT:SWISS 42->257 Y198_HAEIN 4e-15 26.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53181.1 GT:GENE BAF53181.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 235825..236607 GB:FROM 235825 GB:TO 236607 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53181.1 LENGTH 260 SQ:AASEQ MGLELAASGWGILIAGAAVAGWIDAVIGGGGLVLIPLILAVMPQLAPVTALASNKLAAVTGTASAAFTLVRRVKPDKKLLPLYVLVAAVCSGAGALAASLIDKQIMRPMIIVLMLVVGLIVVFKPNFGTGESKTLPTGWKRWAAIVAVGFIAAYDGIFGPGTGMFLIMAFTALLSQNFLSSAAMAKVVNTATNLGALIVFIIGGHMWWTLGLVLAVANVAGAQLGARTVLGGGTRLIRYALLTLVVVMSVYLTWQQIQGM GT:EXON 1|1-260:0| BL:SWS:NREP 1 BL:SWS:REP 42->257|Y198_HAEIN|4e-15|26.7|210/255| TM:NTM 7 TM:REGION 3->25| TM:REGION 30->52| TM:REGION 79->101| TM:REGION 105->126| TM:REGION 142->164| TM:REGION 196->218| TM:REGION 232->254| SEG 23->41|idavigggglvliplilav| SEG 84->100|vlvaavcsgagalaasl| SEG 109->122|miivlmlvvglivv| SEG 210->226|lglvlavanvagaqlga| HM:PFM:NREP 1 HM:PFM:REP 14->252|PF01925|3.6e-32|26.4|231/239|TauE| OP:NHOMO 250 OP:NHOMOORG 223 OP:PATTERN -------------------------------------------------------------------- ----111111111-1---------------------1111----11--111-1111-1----11-----21--------1-------------------1-1------------------------------------------1--------------------------------------1-1--------222222221222232------221-------------1-----------------------------------------------------------------------------------------------1-------1-1----------------------------11--------111-------1-----------11111111111--1-11-1--1-----1111--111-------1----------------------------------------------------------------------------------------111---111--11-1-1---11----111111------1-1--------1---------------11-11---1---1-------1--------1-------1---1---11111111211111111111--1----------111111-------------------------------1111111-11111111111111111--------------------------------------11111111111-1111111-1111111-111121111233311------------1--1-----11---1111111----------1------------------------------------------1--11-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 129-135| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccc //